KEGG   Acidovorax carolinensis P3: CBP35_05410Help
Entry
CBP35_05410       CDS       T04998                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
Organism
acis  Acidovorax carolinensis P3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP TarH Atg14
Motif
Other DBs
NCBI-ProteinID: ART56693
UniProt: A0A240UIN5
LinkDB All DBs
Position
1160794..1162605
Genome map
AA seq 603 aa AA seqDB search
MNQLRIAHKLWLAVVLIVVMLIAVVGFSGYRSAKVQAQADAVAKEMEARVSSAIRWAGLT
ETNAARTQALIVSSDPAVELEFKDVISATSAQISEVQKSLEAMSLAEQDRAQMAKIAAAR
KTMVDLRAQARQLKADGQAEQAVALVKQAYNPAVTAYLQTLRDFVQMQQQTAHTNLAEMA
ASRMLTVKLAAVAVAALLLAIIGGAYFLIRSIQQPLAQANDLAARIAAGDLSMQATITRG
DEFGDLLRSQYAMSDALGRVVHQVRQSTDSIATASAEIATGNHDLSARTEQTSSNLQQTA
AAMEQFTSTIQQSASSAQQASSLAVGATGVARRGGEVVTQVVATMDEINHSSKKIADIIG
VIDGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAEAAKEIKQLINASVE
KVDTGSRLVADAGGTMADIVQSVQRVTDMIGEITAASTEQSVGVAQVNQAVGNLDQMTQQ
NAALVEESAAAAQSLREQAEQLAQMVSVFTVNAAAYGAQAPVARAVAAPVASVAATTARV
QRPVAVSPPAAQRLAGAGTKPGSAAPSAPQQPPRKSSAPAPAPAPASRAAAVAQGGDDDW
ETF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
ctgaaccaacttcgcattgcccacaagctgtggctagcggtcgtccttatcgtggtcatg
ctgatcgcggtggtgggtttttcggggtatcggtccgccaaggtgcaggcgcaggccgac
gccgttgcgaaggagatggaagccagggtttcttcggcgatacgctgggcgggcctcacc
gagaccaatgccgcacgcacgcaggcgctgatcgtcagcagcgatccggccgtggaattg
gagttcaaggacgtcatctctgccacgtcggcgcagatcagcgaagtgcagaaatctttg
gaagccatgtctttggccgagcaggacagggcgcaaatggccaagatcgccgcagcccgc
aaaaccatggtcgatctgcgggcacaggcccggcaactcaaggccgatggccaggctgaa
caggcggtggcgctggtcaagcaagcctacaaccctgcggtcacagcctatctgcagaca
ttgcgcgactttgtgcagatgcagcagcagacagcgcacacgaacctggctgagatggcg
gcctctcgcatgttgaccgtgaagctcgccgccgtggcggtggccgccttgctgttggcc
atcatcggtggggcctattttctgatccgcagcattcagcagcccctggcccaggccaac
gacctcgccgcgcgcattgccgcgggcgacctgagcatgcaggccaccatcacgcgcggc
gatgaattcggcgacctgctgcggtcgcaatacgccatgagcgacgccctgggccgagtg
gtgcatcaagtgcgccagagcaccgacagcatcgccacggccagcgccgaaatcgccacc
ggcaaccacgacctttctgcccgcaccgagcagacgtccagcaacctgcagcaaaccgcg
gccgccatggagcagttcaccagcaccatccagcaaagcgccagcagcgcccagcaggcc
agcagcctggcagtgggcgccaccggcgtggcgcgccggggcggtgaggtggtgacgcaa
gtggttgccaccatggacgagatcaaccacagcagcaagaaaatcgccgacatcatcggc
gtgatcgatggcattgcctttcagaccaacatccttgcactcaatgccgcagtggaggcc
gcgcgcgcaggtgagcaggggcgcggctttgccgtggtggccagcgaagtgcgcagcctg
gcgcagcgcagcgccgaggccgccaaggagatcaagcaactgatcaacgcgtcggtggaa
aaggtcgacaccggctcccggctcgtggccgatgccggcggcaccatggccgacatcgtg
caatcggtgcagcgcgtgaccgacatgattggtgagatcacggccgcatccaccgagcaa
agtgtgggcgtggcccaggtcaaccaggcggtgggcaacctggatcagatgacgcagcaa
aacgccgcgctggtcgaagaaagcgccgctgccgcgcaaagcctgcgcgagcaggccgag
cagctggcgcagatggtgtcggtgttcacggtcaacgcggccgcttatggcgcacaggcg
cccgtggcgcgcgcggtggcggctccggttgccagcgttgcggcaaccacagcccgggtg
cagcgccctgtggcggtcagcccacctgcggcccagcggctggcgggggcgggaaccaag
cccggttccgcagcgccgtctgccccacagcagccgccgcgcaagtcatccgcacctgcg
ccagcgccagcgccggcgagccgtgcggcggccgtggcgcagggcggggatgacgactgg
gaaactttttaa

DBGET integrated database retrieval system