KEGG   Acidovorax carolinensis P3: CBP35_07000Help
Entry
CBP35_07000       CDS       T04998                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
acis  Acidovorax carolinensis P3
Pathway
acis00061  Fatty acid biosynthesis
acis00780  Biotin metabolism
acis01100  Metabolic pathways
acis01130  Biosynthesis of antibiotics
acis01212  Fatty acid metabolism
Module
acis_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:acis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CBP35_07000
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CBP35_07000
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CBP35_07000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acis01004]
    CBP35_07000
Enzymes [BR:acis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CBP35_07000
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CBP35_07000
Lipid biosynthesis proteins [BR:acis01004]
 Fatty acid synthase
  Component type
   CBP35_07000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ART54837
UniProt: A0A240UEH1
LinkDB All DBs
Position
complement(1500278..1501078)
Genome map
AA seq 266 aa AA seqDB search
MGFLTGKKLLITGVLSNRSIAYGIAKACHKQGAELAFSYVGERFKDRITDFAAEFDSKLI
FDCDVGSDEQIERMFADLSQVWPKFDGFVHAIGFAPREAIAGNFLEGLSREGFRIAHDIS
AYSFPAMAKAALPHLNDKSSLLTLSYLGALRSIPNYNTMGLAKASLEASVRYLAEAVGRT
EDGRSIRANGISAGPIKTLAASGIKDFGKLLGRVADAAPLRRNVTIEDVGNVAAFLLSDL
ASGVTAEITYVDGGFSQTAGLSADQV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctgaccggcaaaaaactgctcatcacgggcgtactgtccaaccgctccatc
gcttacggcattgccaaggcctgccacaaacagggcgccgagctggctttcagctacgtg
ggcgagcgcttcaaggaccgcatcaccgactttgccgccgagttcgactccaagctgatt
tttgattgcgacgtgggcagcgacgagcagatcgagcgcatgtttgccgacctgtcccag
gtgtggccgaagtttgacggcttcgtgcacgccatcggctttgcgccgcgtgaagcgatt
gccggcaactttttggaaggcctttcgcgcgaaggtttccgcattgcgcacgacatcagc
gcctacagcttcccggccatggcaaaggccgccctgccccacctcaacgacaagtcgtcg
ctgctgacgctgtcgtacctgggcgcgctgcgttccatccccaactacaacaccatgggc
ctggccaaggccagcctggaagccagcgtgcgctacctggccgaagccgtgggccgcacc
gaagatggccgcagcatccgtgccaacggcatcagcgccggccccatcaagacactggcc
gccagcggcatcaaggactttggcaagctgctgggccgcgtggccgatgccgcgcccctg
cgccgcaacgtgacgattgaagacgtgggcaatgtggcggccttcctgctgtccgacctg
gccagcggtgtgaccgccgaaatcacctacgtggacggcggcttcagccagacggcgggc
ctctccgccgaccaggtctga

DBGET integrated database retrieval system