KEGG   Acidovorax carolinensis P3: CBP35_17515Help
Entry
CBP35_17515       CDS       T04998                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
acis  Acidovorax carolinensis P3
Brite
KEGG Orthology (KO) [BR:acis00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:acis03012]
    CBP35_17515
   03029 Mitochondrial biogenesis [BR:acis03029]
    CBP35_17515
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acis04147]
    CBP35_17515
Translation factors [BR:acis03012]
 Eukaryotic Type
  Elongation factors
   CBP35_17515
 Prokaryotic Type
   CBP35_17515
Mitochondrial biogenesis [BR:acis03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CBP35_17515
Exosome [BR:acis04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBP35_17515
  Exosomal proteins of breast cancer cells
   CBP35_17515
  Exosomal proteins of colorectal cancer cells
   CBP35_17515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ART56352
LinkDB All DBs
Position
complement(3777683..3778873)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETAARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYNFPGDDTPIIRGSAKLALE
GDKGPLGEEAIMKLAEALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIKDTVKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPADKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaagtttgaacgcaccaagccccacgtcaacgtgggcacgatcggtcac
gtggaccatggcaagacgacactgacggcggccatcgccaccgtgctgtcggccaagttt
ggcggcgaagccaaggcctacgaccagatcgacgcagcgcctgaagaaaaggcccgcggc
atcacgatcaacaccgcacacgtggaatacgaaacggctgctcgccactacgcccacgtg
gactgccctggtcacgccgactatgtgaagaacatgatcaccggcgctgcccagatggac
ggcgccattctggtgtgctcggccgctgacggccccatgccccagacccgcgaacacatc
ctgctggcccgccaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgaagaactgctcgaactcgtcgaaatggaagtgcgcgaactgctggataaa
tacaacttccctggcgacgacaccccgatcatccgtggttccgccaagctcgccctggaa
ggcgacaagggcccgctgggcgaagaagccatcatgaagctggccgaagcgctggacacc
tacatccccacgcctgagcgcgctgtggacggtgccttcctgatgcctgtggaagacgtg
ttctccatctctggccgcggcaccgtggtgaccggccgtatcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggcatcaaggacaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggccaagcgggcgacaacgtgggcctgctg
ctgcgcggcaccaagcgcgaagacgtggagcgcggccaagtgctgtgcaagcccggctcg
atcaagccccacacccacttcaccgctgaagtgtatgtgctgagcaaggacgaaggcggc
cgccacacccccttcttcaacaactaccgccctcagttctacttccgcacgaccgacgtc
actggcgccatcgagctgccagccgacaaggaaatggtcatgcctggcgacaacgtgtcg
atcaccgtgaagctgatcaaccccatcgccatggaagaaggtctgcgcttcgctatccgc
gaaggtggccgcaccgtgggcgctggcgtcgtggccaagatcattgcttaa

DBGET integrated database retrieval system