KEGG   Acidovorax carolinensis P3: CBP35_18735Help
Entry
CBP35_18735       CDS       T04998                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acis  Acidovorax carolinensis P3
Pathway
acis00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acis00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP35_18735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acis02000]
    CBP35_18735
Enzymes [BR:acis01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CBP35_18735
Transporters [BR:acis02000]
 Other Transporters
  Pores ion channels [TC:1]
   CBP35_18735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_3 GST_N_2 GST_C_6 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: ART56539
UniProt: A0A240U7M4
LinkDB All DBs
Position
4028943..4029551
Genome map
AA seq 202 aa AA seqDB search
MKLYYAPGACSLSPHIALHEAGLACTPVLVSTKSHKLQDGTDYYSINPLGYVPVLELDSG
ERLREGPAIVQYIADLVPDKQLAPANGTLERYRLQEWLTFIGTEIHQGFGPLFNPATPDE
YKAIAREKLLQRLQWVDSQLAGKPYLMGEQFTVADGYLFTVVNWAGFVGLDLSGLSHLTA
FQARVAARPAVQAAMRAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacgcgcccggcgcctgctccctttcgccccacatcgcgctgcacgaa
gccggcctggcctgcacgcccgtgctggtcagcaccaagagccacaagctgcaggacggc
accgactactacagcatcaacccactgggctatgtgcccgtgctggagctggacagcggc
gagcgcctgcgcgaaggcccggccatcgtgcagtacatcgccgatctcgtgccagacaag
caactggccccggcgaatggcaccctggagcgctaccgcctgcaggagtggctgaccttc
atcggcaccgaaatccaccagggctttggcccgctgttcaacccggccacgcccgacgag
tacaaagccatcgcgcgcgaaaagctgctgcagcgcctgcagtgggtggacagccagctc
gcgggcaagccctacctgatgggcgagcagttcaccgtggccgatggctacctgttcacc
gtggtcaactgggccgggttcgttggccttgacctctcgggcctgagccacctcaccgct
tttcaggcccgtgttgccgcacgccccgcagtgcaggcggccatgcgcgccgaaggtctg
ctcaagtaa

DBGET integrated database retrieval system