KEGG   Aeropyrum camini: ACAM_0708Help
Entry
ACAM_0708         CDS       T02858                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
acj  Aeropyrum camini
Pathway
acj03030  DNA replication
acj03410  Base excision repair
acj03420  Nucleotide excision repair
acj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ACAM_0708
   03410 Base excision repair
    ACAM_0708
   03420 Nucleotide excision repair
    ACAM_0708
   03430 Mismatch repair
    ACAM_0708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acj03032]
    ACAM_0708
   03400 DNA repair and recombination proteins [BR:acj03400]
    ACAM_0708
Enzymes [BR:acj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACAM_0708
    6.5.1.6  DNA ligase (ATP or NAD+)
     ACAM_0708
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ACAM_0708
DNA replication proteins [BR:acj03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ACAM_0708
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ACAM_0708
DNA repair and recombination proteins [BR:acj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ACAM_0708
   NER (nucleotide excision repair)
    Other NER factors
     ACAM_0708
   MMR (mismatch excision repair)
    Other MMR factors
     ACAM_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: BAN90177
UniProt: U3T9J0
LinkDB All DBs
Position
complement(655230..657041)
Genome map
AA seq 603 aa AA seqDB search
MPFKPVAEAFASMERITSRTQLTLLLTRLFKSTPPGAIGIVVYLIQGKLGPDWKGLPELG
VGEKLLVKAIALAYKATEERVEKLYKSIGDLGSVAERLSREYRARASRAVTLEAFMAGGG
EALTVRRVYNTLYRIAMAQGEGSRDIKLRLLAGLLADAEPVEAKYIVRFVEGRLRVGVGD
ATILDALAMAFGGGAHARPVIERAYNLRADLGYIAEVVAREGVEALRGVKPQVGVPIRPM
LAERGRDPAEILRKVGGRAVVEYKYDGERAQIHKKDGEVYIYSRRLENITRMFPDVVEMA
RKGLKAREAIVEGEIVAVDPDNYELQPFQVLMQRKRKHDIHRVMREVPVAVFLFDALYVD
GEDLTSKPLPERRSRLREIVVETPLWRLAESIETSDPEELWTFFLKAIEEGAEGVMVKAV
HRDSVYTAGVRGWLWVKLKRDYKSEMMDTVDLVVVGAFYGRGKRGGKLSSLLMAAYDPER
DVFPTVCKVATGFTDEELDRMNEMLKKHIIPRKHPRVESRIEPDVWVEPALVAEILGAEL
TLSPMHTCCLNAVRPGVGISIRFPRFIRWRDDKRPEDATTTQELLEMYKRQLRRVEEEAA
EKV
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcaagcctgtggccgaggctttcgcctctatggagaggataacatctaggacg
cagcttaccctcctcctcacgaggctcttcaagtccacgcccccgggggcgataggcatt
gtcgtctacctgatccaggggaagctggggccagactggaaggggctgcccgagctgggg
gttggggagaagcttctggtgaaggcgatagccctggcttacaaggctactgaggagagg
gttgagaagctctacaagtctataggcgacctggggagcgttgcggagaggctctcccgg
gagtacagggctagggcgtcgagggctgtgaccctggaggccttcatggccggagggggg
gaggcgctgactgttaggagggtgtacaacacactctacaggatagcgatggcccagggg
gagggtagcagggacatcaagctgaggctcctcgccggcctcctggcggacgcggagcct
gtggaggccaagtatatcgtgaggttcgtggagggcaggctgagggtcggcgtcggcgac
gccactatactcgacgccctggccatggccttcggagggggcgcccacgccaggccggtt
atagagagggcctacaacctcagggccgacctgggctacatcgcggaggttgtggcgagg
gagggggttgaggcgctgaggggcgtgaagccccaggtgggggttccgataaggccaatg
ctcgccgagagggggagggacccggctgagatactgaggaaggtcggcgggagggcggtg
gtggagtacaagtacgacggggagagggcgcagatccacaagaaggacggggaggtatac
atctactcgaggaggctggagaacattacgaggatgttccccgacgtggttgagatggcc
aggaaggggcttaaggcgcgggaggcgatagtggagggcgagatagtggctgtagacccg
gacaactacgagctacagccgttccaggtcctcatgcagaggaagaggaagcacgacata
cacagggtcatgagggaagtgccggtggccgtcttcctcttcgacgccctctacgtggac
ggcgaggacctcaccagcaagcccctcccggagaggcgtagcaggctgagggagatagtg
gtggagacgcccctatggaggcttgccgagtccatcgagaccagcgacccggaggagctg
tggaccttcttcctgaaggcgatagaggagggggccgagggggttatggtcaaggcggtc
cacagggactccgtctacaccgcgggcgtcaggggatggctctgggttaagctcaagagg
gactacaagagcgagatgatggacaccgtcgacctcgtcgtcgtgggggccttctacggc
agggggaagaggggcggcaagctgagcagcctgctgatggcggcctacgaccccgagagg
gacgtgttccccactgtctgcaaggtcgccacgggcttcacagacgaggagctagacagg
atgaacgagatgctgaagaagcacatcatccccaggaagcacccgagggtggagtcgcgg
atagagcccgacgtgtgggtggagccagccctagtcgccgagatactgggggcggagctc
accctctcccccatgcacacctgctgcctcaacgctgtgaggcccggggtggggataagc
ataaggttccccaggttcataaggtggagggacgataagaggcccgaggacgccaccaca
acccaggagctgctcgagatgtataagaggcagttgaggagggttgaagaggaggcggcg
gagaaggtgtag

DBGET integrated database retrieval system