KEGG   Acidovorax sp. KKS102: C380_02460Help
Entry
C380_02460        CDS       T02290                                 

Definition
(GenBank) acetylornithine deacetylase ArgE
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00220  Arginine biosynthesis
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01130  Biosynthesis of antibiotics
ack01210  2-Oxocarboxylic acid metabolism
ack01230  Biosynthesis of amino acids
Module
ack_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    C380_02460
Enzymes [BR:ack01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     C380_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AFU44218
UniProt: K0HMM9
LinkDB All DBs
Position
complement(531000..532160)
Genome map
AA seq 386 aa AA seqDB search
MTLSPHALELAQTLVRMNTVSHHSNLELIHFIRDHLARLGVKSRLTFNEDKTKANLFATL
GEGKPAGIILSGHTDTVPWDGQDWTMDPLSALVKDGNLYGRGSADMKAFIGVAVSQAEQF
LNSDAPFALHYAFSYEEEIGCFGVKELIADLRDANIQPLACIVGEPTSMIPAIAHKGVYR
YKCCVRGKEAHSSLTPHSVNAIEMAARVVGRVRDMAEDFEKSEPRFEGFDVPFSTSSVGQ
FHGGIADNVVPRDAEFRYEFRDLPTANAAQMQSEVVAYAKSLEPAMKKVAPAAGFEFETI
CEIPSFLGSKDDPVTRLAQELSGEKSTTLVAFGTEAGLFKNAGISTVVCGPGSIQQAHQP
DEYVSLEQLGRCEAFMQGLARTRTLG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacactctccccgcacgccctcgaacttgcgcaaaccctggtgcgcatgaacaccgtc
agccaccactccaacctggagctgatccatttcatccgcgaccacctggcccggctgggc
gtgaaaagccgcctgaccttcaacgaagacaagaccaaggccaacctgttcgccacgctg
ggcgagggcaagcccgcgggcatcatcctctcgggccacaccgacacggtgccgtgggat
gggcaggactggaccatggacccgctgagtgcgctggtcaaggacggcaacctgtacggg
cgcggcagtgccgacatgaaggccttcatcggcgtggccgtgtcgcaggccgagcagttc
ctgaacagcgatgcgccgtttgcccttcactatgcgttcagctacgaggaagagattggc
tgctttggcgtgaaggaactcatcgccgacctgcgcgatgccaacatccagcccctggcc
tgcatcgtgggcgagcccaccagcatgatccccgccatcgcgcacaagggcgtgtaccgc
tacaagtgctgcgtgcgcggcaaggaggcgcattcctccctcacgccgcattcggtcaac
gccatcgagatggccgcccgcgtggtgggccgggtgcgcgacatggcggaagactttgaa
aagagcgagccccgcttcgagggctttgacgtgccgttttccaccagcagtgtgggccag
ttccacggcggcatcgccgacaacgtggtgccgcgcgacgccgagttccgctacgagttc
cgcgacctgcccacggccaacgccgcgcagatgcagtcagaagtggtggcctacgccaaa
tcgctggagcccgccatgaagaaggtggcgccggcagcgggtttcgaattcgaaaccatc
tgcgaaatcccgagcttcctgggcagcaaggacgacccggtgacgcgcctggcgcaagag
ctgtcgggcgaaaagagcaccacgctggtggcctttggcaccgaggcgggcctgttcaag
aacgcaggcatctccaccgtagtgtgcggccccggcagcatccagcaggcgcaccagccg
gatgaatacgtgagcctagaacagctgggacgctgcgaagcgttcatgcaggggctggcg
cgaacgcgcacgctgggctga

DBGET integrated database retrieval system