KEGG   Acidovorax sp. KKS102: C380_03760Help
Entry
C380_03760        CDS       T02290                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00473  D-Alanine metabolism
ack00550  Peptidoglycan biosynthesis
ack01100  Metabolic pathways
ack01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C380_03760 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C380_03760 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C380_03760 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ack01011]
    C380_03760 (ddl)
Enzymes [BR:ack01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C380_03760 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ack01011]
 Precursor biosynthesis
  Amino acid ligase
   C380_03760 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp ATPgrasp_ST CPSase_L_D2 Neuropep_like GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AFU44475
UniProt: K0HXF2
LinkDB All DBs
Position
830803..831792
Genome map
AA seq 329 aa AA seqDB search
MTLPESNIDVKSLGKVAVLMGGDSAEREVSLMSGSGVLQALRSRGVDAHAFDPAQNALGD
LKRDGYARCFIALHGRHGEDGTVQGALELLRIPYTGPGVMASAIAMDKVMTKRVWLAEGL
PTPRYVWLAPDRQQREVVRTVPDELGLPLIVKPPREGSSIGVTKVRGYSDMQEAVQLSAQ
YDPDVLCEEFIEGEEVTCPVLGQGANARALPVIRIVAPDGAYDYQNKYFTDDVKYQCPSG
LPEAEEREIQRIVLEAYRTLGCRGWGRADLMIRASDRKPFLLEMNTSPGMTGHSLVPMSA
RASGISYEELCLRILADAALDTPAKPKAA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcctgaatcgaatatcgacgtgaaatcgctgggcaaggtcgccgtcctgatg
ggcggagactcggccgagcgcgaggtgtcgctgatgtcgggcagcggcgtgctgcaggcg
ctgcgctcccgtggcgtcgatgcccatgcgtttgaccctgcgcagaacgcgctgggtgat
ttgaagcgcgacggctatgcgcgctgcttcatcgcactgcatggtcgccatggcgaagac
ggcacggtgcagggcgcgctggagctgctgcgcattccgtacaccggccctggcgtgatg
gcgtcggcgattgccatggacaaggtcatgaccaagcgggtgtggctggccgagggcctg
cccacgccgcgctatgtgtggctggcccctgaccgccagcagcgcgaagtggtacgcacc
gtgcccgacgagctgggtctgcccctcatcgtcaagccgccgcgcgaaggttcgtccatc
ggcgtgaccaaggtgcgcggctattccgacatgcaggaggccgtgcagctgtcggcccag
tacgaccccgacgtgctgtgcgaagaattcatcgagggcgaagaggtgacctgccccgtg
ctgggccagggcgccaatgcccgtgcgttgccggtgatccgcatcgtggcgcccgatggc
gcctatgactaccagaacaagtacttcaccgacgacgtgaagtaccagtgcccgagcggc
ctgcccgaggccgaggagcgcgagatccagcgcatcgtgctggaggcctatcgcaccctg
ggctgccggggctggggccgcgccgacctgatgatccgtgcgagtgaccgcaagcccttc
ctgctggagatgaacacgtcccccggcatgacaggccattcgctcgtgcccatgtcggcc
cgggcctcaggcatcagctacgaagagctgtgcctgcgcatccttgcggatgcggcactg
gacacgcccgcaaagccaaaggctgcctga

DBGET integrated database retrieval system