KEGG   Acidovorax sp. KKS102: C380_08190Help
Entry
C380_08190        CDS       T02290                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ack  Acidovorax sp. KKS102
Brite
KEGG Orthology (KO) [BR:ack00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C380_08190
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C380_08190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin AlaDh_PNT_C FAD_binding_3 NAD_binding_7 DAO Thi4 K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AFU45343
UniProt: K0HQL7
LinkDB All DBs
Position
1784568..1786187
Genome map
AA seq 539 aa AA seqDB search
MLDEQLKTQLAAYLERVQQPFELVASLDDSETARDMRELLTTIQSLRSDKITLRTDGNDA
RKPSFSLQRVGATNSLRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIDSIKALDGDFN
FEVYMSLTCHNCPDVVQALSLMAVVNPKIKTTVIEGGAFQQEVTERVIMAVPMVFLNGQV
FGSGRMTIEEIVAKLDTGSAAREAAKLSAKDPYDVLIVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVNDTLAIENYISVLETDGPKFAAALEAHTRAYGVDIMNLQRADKLIPAAQPG
GLIEVQLANGGSLKAKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGVEAAIDLAGVVAHVTLIEFADQLKADAVLVNKLKSLPNVTIHTNAQTTEITGA
DGKVNGLKYKDRATNVEHTVALEGVFVQIGLVPNTEWLKGTVELSRFGEIIVDSHGRTNI
PGVFAAGDCTTVPFKQIVIAAGDGSKAALSAFDHLIRMPVVATGAPSGAAVADRVAVPV
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaacaactcaagacccaactcgccgcctacctggagcgtgtgcagcagccg
tttgagctggtggcttccctggacgacagcgagacggcgcgcgacatgcgcgagctgctg
acgaccatccagtccctgcgcagcgacaagatcaccctgcgcaccgacggcaacgatgcg
cgcaagccatccttcagcctgcagcgcgtgggcgccaccaacagcctgcgctttgccggc
ctgccgctgggccatgagttcacttcgctggtgctggccctgctttggacgggtggtcac
ccgcccaaggtcgagcaggacgtaattgattccatcaaggccctggatggcgacttcaac
ttcgaggtctacatgagcctgacctgccacaactgcccggacgtggtgcaggcactgtcg
ctcatggccgtcgtcaacccgaagatcaagaccaccgtcatcgaaggcggcgccttccag
caggaagtgaccgagcgcgtaatcatggccgtgcccatggtgttcctcaatggccaggtg
ttcggctccggccgcatgaccattgaagaaatcgtcgccaagctcgacaccggttctgcc
gcccgcgaagcggccaagctgagcgccaaggacccgtacgacgtgctcatcgtcggtggt
ggccccgcaggtgccgcagccgccgtgtacgccgcccgcaagggcatccgcaccggtgtg
gcggccgagcgctttggcggccaggtgaatgacacgctggccatcgagaactacatctcg
gtgctcgaaaccgacggccccaagttcgccgccgcgctcgaagcccacacccgtgcctat
ggcgtggacatcatgaacctgcagcgcgccgacaagcttattcctgctgcgcagcccggc
ggcttgattgaagtgcagctggccaacggcggctcgctcaaggccaagacggtgatcctg
tccaccggcgcccgctggcgcaacgtgaacgtgcccggcgaagccgagtacaaaaacaag
ggcgtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtcggtc
atcggcggcggcaacagcggtgtcgaagccgcgattgacctcgctggcgtcgtggcccac
gtcacgctcatcgaatttgcggaccagctcaaggccgacgccgtgctggtcaacaagctc
aagagcctgcccaacgtgaccattcacaccaacgcgcagaccaccgaaatcaccggcgct
gatggaaaggtcaatggcctcaagtacaaggaccgcgcaaccaacgtggagcacacagta
gcgctggagggcgtgttcgtgcagatcggcctggtgcccaataccgaatggctcaagggc
acggtggagctgtcgcgctttggcgaaatcattgttgattcgcacggtcgcaccaacatc
cccggcgtgtttgcggcgggcgattgcaccaccgtgcctttcaagcagatcgtgattgca
gcgggcgatggctcgaaggcagcgctgagcgcctttgaccacctgattcgcatgcccgtg
gtggcgaccggtgcgcctagcggcgctgcagtagccgatcgagtggctgtccctgtgtaa

DBGET integrated database retrieval system