KEGG   Acidovorax sp. KKS102: C380_11950Help
Entry
C380_11950        CDS       T02290                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ack  Acidovorax sp. KKS102
Brite
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C380_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: AFU46091
UniProt: K0IAC5
LinkDB All DBs
Position
complement(2600881..2601405)
Genome map
AA seq 174 aa AA seqDB search
MKIRFAFALCSLAAVALVGCASHLSGNRATAKLEPTRGNTANGTVTFVQTGDGVQVSGEV
RGLKPGAEHGFHVHEKGDCSSGDGMSTGGHFNPTAKPHGAHGAAEHHTGDLPSLKADKYG
VAAFSFVSKSISVGGPTTDIVGKGLIVHRDPDDYKTQPTGNAGPRLACAVIASK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcgttttgcttttgcactgtgttccctggctgctgtggcgctggtgggttgc
gcctcccatctgtccggcaaccgcgccaccgccaagctggagcccacccgtggcaatacc
gccaacggcacggtcacgttcgtgcagacgggtgatggcgttcaggtgtctggcgaggtg
cgtggcctcaagccgggcgcagagcatggctttcacgtccacgaaaagggtgactgcagc
agcggcgacggcatgagcaccggcggacatttcaaccccaccgccaaaccccacggtgcc
cacggcgctgccgagcaccacaccggcgacctgcccagcctcaaggccgacaagtacggc
gtggccgccttcagctttgtgtcgaaatccatcagtgtgggcggtccgaccaccgacatc
gtcggcaaggggctgatcgtccaccgtgaccctgacgactacaagacccagcccaccggc
aacgcaggcccgcgcctggcctgtgcggtgatcgcgtccaagtga

DBGET integrated database retrieval system