KEGG   Acidovorax sp. KKS102: C380_21915Help
Entry
C380_21915        CDS       T02290                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00564  Glycerophospholipid metabolism
ack01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C380_21915
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C380_21915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like Lycopene_cycl 3HCDH_N NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AFU48075
UniProt: K0I6A9
LinkDB All DBs
Position
complement(4758545..4760137)
Genome map
AA seq 530 aa AA seqDB search
MTIATAPLPTRRADLLARLAQPHQYDLAVIGGGATGLGVALDAAARGFSVVLVDSHDFAK
GTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLPFVMPSYRFWETPF
YGVGLMMYDALAGKAGLGATQFLGRESTLRCLPTARTEGLKGGVKYWDGQFDDARLALAL
ARTAASLGALLVNYCPAKSLVHEAGKVVGFVCEDADSGQQFTVRARSVVNATGVWVDTLR
QMDGEAIGRPVKPMVAPSQGVHIVVDREFLPSDHALMVPKTADGRVLFAVPWLGKLILGT
TDSPRQDVVREPEPFREEVRFILEESARYLTRAPRVEDIRSIWVGLRPLVKPQDDDGDNT
KKISREHTVLASRSGLITVTGGKWTTYRAMAEDVLQKCFTTGLLPEKPAGVTNQLPLVGT
PREPVQHRISDAQGLHSYGSEAAEVRATLGAQTDLGGGLTEAMVRFAARFEYACTVEDVL
ARRSRLLFLDARKALELAPVVARILREELGSDPQLDAFLALAPQYLHVPA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgccaccgctcccctccccacacggcgcgccgacctcctggcccgcctggcc
cagccgcaccaatacgacctcgccgtgatcggcgggggcgcgacgggcctgggggtggcg
ctggatgctgcggcacgcggcttcagcgtggtgctggtggattcccacgatttcgccaaa
gggacgtcgtcccgcgccacgaagctggtgcatggcggagtccgttacctggcgcagggc
aatatcgccctggtgcgcgaggcgctgcacgagcgcaccacgctgctgcacaacgccccc
catctggcgcagccgctgcctttcgtgatgccgtcgtaccgtttctgggaaacccccttt
tacggcgtcggactgatgatgtacgacgcgctggcgggcaaggcgggcctgggcgccacc
cagttcctggggcgcgagagcaccctgcggtgcctgcccactgcccggaccgagggcctg
aaaggcggggtcaaatattgggacggccagtttgacgatgcgcgcctggctctggcgctg
gcgcgcacggcggccagcctgggcgccttgctggtcaattactgcccagccaagtcgctg
gtccacgaggccggcaaggtcgtgggctttgtctgcgaggacgcggacagcggccagcag
ttcaccgtacgcgcccgctcggtggtcaacgccacgggcgtgtgggtggacaccctgcgc
cagatggacggcgaagccatcgggcggcccgtcaagcccatggtggcgcccagccagggc
gtgcacattgtggtggaccgggagttcttgccgtccgaccacgccttgatggtgcccaag
acggccgatggccgcgtgctgtttgccgtaccctggctgggcaaactcattctgggcacc
accgacagtccgcgccaggacgtggtgcgggagcccgagccctttcgggaggaagtgcgt
tttatcctggaggagtccgcccgctacctgacccgcgcgccccgcgtcgaggacatccgg
agcatctgggtgggcttgcgcccgctggtcaagccgcaggacgacgatggcgataacacc
aagaagatcagccgggaacacacggtgctggcgagtcgcagcggcctgatcaccgtgacc
ggcggaaaatggaccacctaccgggccatggccgaagatgtgttgcaaaaatgcttcacc
acgggtctgctgcccgaaaagcctgccggtgtgacgaaccagctgccgctggtgggcacg
ccacgggagccggtccagcaccggatcagcgacgcccaggggctgcactcctatggcagc
gaagcggccgaagtgcgggcaacgcttggcgcgcaaacggatctgggtggcggcctgacc
gaggccatggtgcgctttgcggcccgttttgaatacgcctgcactgtggaggatgtgctg
gcgcgccgctcgcgcctgctgttcctggacgcccgcaaggccctggagctggcgcccgtc
gtcgcccgtatcctgcgcgaagagctgggctctgacccgcaactggacgccttcctggcg
ctggcgccccagtatctgcatgtgcctgcataa

DBGET integrated database retrieval system