KEGG   Acidovorax sp. KKS102: C380_22090Help
Entry
C380_22090        CDS       T02290                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ack00405  Phenazine biosynthesis
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01130  Biosynthesis of antibiotics
ack01230  Biosynthesis of amino acids
ack02024  Quorum sensing
Module
ack_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ack00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C380_22090
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    C380_22090
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C380_22090
Enzymes [BR:ack01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     C380_22090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AFU48110
UniProt: K0I6C6
LinkDB All DBs
Position
complement(4796898..4798397)
Genome map
AA seq 499 aa AA seqDB search
MITELEFKSLASEGYNRIPLMAEAFADLETPLSLYLKLAHTKDGGKHSFLLESVVGGERF
GRYSFIGLPARTLLRACGFGDQAKTEVVTDGQVVETAAGNPLDFIAEYQKRFKVALRPGL
PRFCGGLAGYFGYDAVRYIEKKLETTCPPDTLGCPDILLLQCEELAVIDNLSGKLYLIVY
ADPAQPEAYTRAKKRLRELKEQLKYSVSAPVVKATESHPAQRDFAKADYLAAVHRAKELI
AAGDFMQVQVGQRIHKRYTESPLSLYRALRSLNPSPYMYFYDFGDFHVVGASPEILVRQE
KTDEGTKVTIRPLAGTRPRGATPEKDKATEVELINDPKERAEHVMLIDLARNDIGRIAKT
GTVKVTEAFAVERYSHVMHIVSNVEGILHDGMTSMDVLKATFPAGTLTGAPKVHAMELID
QLEPTKRGLYGGACGYLSYAGDMDVAIAIRTGIIKNGTLYVQAAAGVVADSVPELEWKET
EHKARALLRAAELVEEGLE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacagaacttgaattcaaaagcctggccagcgaaggctacaaccgcattccgctc
atggcagaggcctttgcggacctggaaaccccgctctcgctctatttgaagctggcgcat
accaaagacggcggcaagcatagctttctgctcgaatcggtggtgggcggcgagcgcttc
gggcgttacagcttcatcggcctgcccgcccgcactctgttgcgtgcctgcggtttcggt
gaccaggccaagaccgaggtggtgaccgatggccaggtggtggagaccgctgcgggcaac
ccgctggatttcattgcggagtaccaaaagcgcttcaaggtggccctgcgccccggcctg
ccgcgcttttgcggcggcctggcgggttactttggctacgacgcggtgcgctacatcgag
aaaaagctcgaaaccacttgcccgcccgacaccctgggttgccccgacatcctgctgctg
cagtgtgaggagctggcggtcatcgacaacctctcgggcaagctctacctcatcgtctac
gccgacccggcccagcccgaggcctacacccgcgccaaaaaacgcctgcgtgaactgaaa
gagcagctcaagtattcggtgagcgccccggtggtcaaggccaccgaaagccaccccgcc
cagcgcgactttgccaaggccgattacctggctgccgtgcaccgcgccaaggagctgatc
gccgccggtgacttcatgcaggtgcaggtgggccagcgcatccacaagcgttacaccgag
tcgcccctgtcgctgtaccgcgcgctgcgttcgctgaacccatcgccgtacatgtacttc
tacgactttggtgacttccacgtggtgggcgctagccccgagatcctggtgcgccaggaa
aagaccgacgaaggcaccaaggtcaccatccgccccttggccggcacccgcccacgcggc
gccacgcccgagaaggacaaggccaccgaggtcgagctcatcaacgaccccaaggagcgc
gccgagcacgtgatgctcatcgacctggcgcgcaacgacatcggccgcatcgccaagaca
ggcaccgtgaaggtgaccgaggcctttgcggtggagcgctacagccatgtgatgcacatc
gtgagcaacgtggaaggcatcctgcacgacggcatgaccagcatggacgtgctcaaggcc
accttccctgcgggcacgctgaccggcgcacccaaggtgcacgccatggaactcatcgac
cagctcgaacccaccaagcgcggcctgtacggcggcgcctgtggctacctgagctacgca
ggcgacatggacgtggccattgccattcgcaccggcatcatcaagaacggcacgctctat
gtgcaggcggcggctggtgtggtggccgattcggtgcccgagctggagtggaaagaaacc
gagcacaaggcccgcgcactgctgcgcgctgcagagttggtcgaggaggggctggaatga

DBGET integrated database retrieval system