KEGG   Acholeplasma laidlawii: ACL_0993Help
Entry
ACL_0993          CDS       T00659                                 

Definition
(GenBank) ABC-type transport system, permease and ATPase components
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
acl  Acholeplasma laidlawii
Pathway
acl02010  ABC transporters
Module
acl_M00707  Multidrug resistance, MdlAB/SmdAB transporter
Brite
KEGG Orthology (KO) [BR:acl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ACL_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase DEAD EI24 AAA_15 AAA_21 ResIII AAA_29 AAA_23 ABC_membrane_3 AAA AAA_22 AAA_7 Zeta_toxin NB-ARC NACHT AAA_17 AAA_30 AAA_14 TsaE AAA_16 CbtB
Motif
Other DBs
NCBI-ProteinID: ABX81603
UniProt: A9NGX3
LinkDB All DBs
Position
complement(1014584..1016380)
Genome map
AA seq 598 aa AA seqDB search
MRDFQDNHAAHADKTLIKRLLKYLKPYRGKFIGAFFMMFVTIFTNLVLPLATGWSIDYMT
KTDVTNDQKMLALAVATLIGLVILMISVVVGFFQQRILQEIGQDVTHVMRKEVFEHIENL
SIGQINLLPVGKLVTRATNDPGNISDMFTNTIVNLLRNVLMMIVIAVVLLVLNWQMALLT
FLTLPLILLASSIFRKYSRTAYRNVRTNISELNGYLSENLSGMKITQIFNQEEKKVQNFK
LLNDKLMKSYYREINTFGIYRPIIWMISMIATILTVYFGVTTVIDGALSVGLFISFYIYV
GQFFEPIQQISEQFNALQNGFSSAEKIFDVLDTKPDIIDDVDAIELKKFDGQIEFKNVWF
SYIEGEWILKDVSFKVNPNETVAFVGATGSGKTTILQLIVRNYDIQKGQILIDGIDIKTI
KRSSLRKFVGQMLQDVFLFSGTIRDNITLGDPDITDEDIKRASNYVGLDYILNKLPEGLD
HVVKERGNNFSSGERQLISFARAVVYNPSLMILDEATANIDSETETIIQESLNKMMNIST
MLIVAHRLSTIQHSDRIIVMSKGEIVESGKHQELLKQNGLYYNLYQLQYDKKEGETHV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgattttcaagacaaccatgccgcacatgctgataaaacattaattaagcgatta
ttaaaatacttaaaaccgtatagaggtaagttcattggtgcattctttatgatgtttgtt
acgatatttacaaatcttgtattaccacttgcaaccggttggtcgattgactatatgact
aaaacagatgtaacaaacgatcaaaagatgctagcattagcagttgctacacttataggt
ttagtcattttaatgattagtgttgttgttggatttttccaacaacgtatcttacaagaa
attggccaagatgtgacgcacgtcatgcgaaaagaagtatttgaacatattgaaaattta
tcaattggtcaaatcaatttattaccagtaggtaaattagttactcgtgcaacaaatgac
ccaggtaacatttctgatatgtttacaaacacgattgttaacctattaagaaacgttctt
atgatgattgtgattgcagttgtgctattagtactaaattggcaaatggcactcctaact
ttcttaaccttaccacttatcttactagcaagctccatttttaggaaatactcaagaaca
gcatatagaaatgtgcgtacaaacatttcagaactcaatggctatttatctgaaaactta
agtggtatgaaaatcactcaaatatttaatcaagaagaaaagaaggttcaaaactttaag
ttattaaatgataagttaatgaaaagttattatagagaaatcaatacatttggtatttat
agaccgattatttggatgatttctatgatagctactatccttacagtatactttggtgta
acaaccgtcattgatggtgccttaagtgtcggattatttatttcattttacatttatgtt
ggacagttcttcgaaccaatacagcaaatatctgaacaatttaatgcacttcaaaatggt
tttagttcagcagaaaaaatatttgacgtcttagatacaaaaccagatattatagatgat
gtggacgcgattgaactaaagaaatttgatggacaaatcgaatttaaaaacgtttggttt
agctatattgaaggtgaatggatcttaaaagatgtttcctttaaagtcaatccaaatgaa
acggtagcatttgttggtgccacaggtagtggtaaaacaacaattctacaattgattgtt
agaaactacgatatccaaaagggacaaatccttattgatgggattgatattaaaaccatt
aagcgttcatccttacgtaaatttgttggtcaaatgctacaagatgtcttcttatttagt
ggaaccattagagataacatcacacttggtgaccctgatattacagatgaagacattaaa
cgtgcaagtaattatgtgggtctagattatatcttaaacaagctacctgaaggtttagat
catgtggttaaagaacgtggtaacaactttagtagtggtgaaagacaattaattagtttt
gctagagcagttgtctataatccgagtctgatgattctagatgaggcaacagcaaacatt
gactctgaaacagaaacaattattcaagaatccttaaataaaatgatgaatatttctaca
atgcttattgttgcacatagactatctactattcaacatagtgatagaattattgttatg
agtaaaggtgaaattgtagaatcaggtaaacatcaagaacttttaaaacaaaatgggtta
tactataacctatatcaattgcaatatgacaaaaaggaaggtgaaacacatgtttag

DBGET integrated database retrieval system