KEGG   Acholeplasma laidlawii: ACL_1082Help
Entry
ACL_1082          CDS       T00659                                 

Gene name
dpnII
Definition
(GenBank) type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
acl  Acholeplasma laidlawii
Brite
Enzymes [BR:acl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     ACL_1082 (dpnII)
Prokaryotic defense system [BR:acl02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    ACL_1082 (dpnII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ABX81692
UniProt: A9NH62
LinkDB All DBs
Position
complement(1116364..1117215)
Genome map
AA seq 283 aa AA seqDB search
MKRSFDDIIESIKEGLSTYDYFVDFKKVFSIVEHIELKLNTLNYLIGKDNFDEAFKVLLE
EHPNIITVIPVLLAVRENNIQVLDEVMKSYNFNYYDPNVNYIEFIRKTGLIDLFYDKRIK
NLVDYVTGVEVGLDTNSRKNRSGKMMSQIVLKNLKDIPSIDILEEANTSKIYKEFGVDIS
NTLKDTKSNKRFDFVIKDKMGHIYLIETNYYGTSGSKLNETSRSYAKLAKDIKEIDNVSF
VWITDGKGWLSTKKNLEEAYNDIEHLYTLYDLEHKVLHKLFNT
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatcatttgatgacattatagaatctataaaagagggtttatcaacatatgat
tattttgttgattttaaaaaagtctttagtatagtagagcacatagaattaaaacttaat
acattaaactaccttatcggaaaagataattttgatgaggcttttaaagtgttattagaa
gaacacccgaatatcataactgttatacctgtattactcgcagttagggaaaacaacatt
caagtgttagatgaagtaatgaaatcctataatttcaactattatgatccgaatgtcaat
tatatagagtttattagaaaaacaggacttatagacttgttttacgataaacgtatcaaa
aacctagtagattatgtcactggtgttgaagttggactagatactaatagtagaaaaaat
agaagtggcaaaatgatgtcgcagattgttttaaagaacttgaaagatattccaagcata
gacatacttgaagaagctaatacaagtaaaatatataaggaatttggtgtagatatatct
aatactttaaaagacacaaaatcaaacaagcgttttgattttgtgataaaagataaaatg
ggtcatatatatcttatagaaactaactactatggaacaagtggttctaaattaaacgag
acttcaagaagttatgctaaactagccaaagatatcaaagagatagacaatgtatcgttt
gtttggattactgatggaaaaggctggttatccactaaaaagaatttagaggaagcttat
aacgatatagaacatttatataccttatatgatctagaacataaagtgctccataaacta
tttaatacatag

DBGET integrated database retrieval system