KEGG   Acholeplasma laidlawii: ACL_1204Help
Entry
ACL_1204          CDS       T00659                                 

Gene name
trxB3
Definition
(GenBank) thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acl  Acholeplasma laidlawii
Brite
KEGG Orthology (KO) [BR:acl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACL_1204 (trxB3)
Enzymes [BR:acl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ACL_1204 (trxB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored FAD_binding_2 GIDA HI0933_like K_oxygenase NAD_binding_7 FMO-like AlaDh_PNT_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABX81803
UniProt: A9NHH3
LinkDB All DBs
Position
complement(1254343..1255311)
Genome map
AA seq 322 aa AA seqDB search
MFNFNLDTQLHNTFNTQLIYDFLVIGGGPSGLNASIYAHRLGMTTGIITYDIGGQLLNTN
DVDNYLGLPNDTGSGLTEKFISHVKQFEIPVLDKIYVDKITKDNNLFQIYLNNGDIIQSK
TVLLSTGSTPKKLGIPGEDIFDAKGISYCAICDAPFYKDKHVVVAGGGNSAIESALDLAK
WAKKVTVIQRSKFRADKILLENMYKNDKIDYMLETQILEVHGRNQVDSLTILDKKTNQTS
NFKADGLFVAIGMKPNTKFIKDFVTLNDYHEVIVNSKQETNIPGLYAAGDMVDQPHKQII
IAAAEGAKAAIHANQYLKFKGE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactttaatttagacacacaacttcataacacattcaacacacaattaatatac
gactttcttgttattggtggtggtccatctggattaaatgcaagcatttatgcacatcgt
cttggtatgacaaccggtatcattacttatgatataggtggtcaattactaaataccaat
gatgtagataactacttaggtttaccaaatgatacaggtagtggattaactgaaaagttt
atctcacatgtaaaacagttcgaaattccagttttagataaaatttatgtcgataaaatc
acaaaagataataatttatttcaaatatatttaaacaatggtgatatcattcaatcaaaa
acagttttactctcaacaggaagcacacctaaaaagttaggtattccaggagaagatatc
tttgatgcgaaaggtatatcttattgtgcgatctgtgatgcaccattttacaaggacaaa
cacgttgttgttgcaggtggtggaaactctgcaatagaatctgcactcgatttagctaaa
tgggctaaaaaagttacagttattcaaagatcaaagtttagagcagataaaatactactc
gaaaatatgtataaaaacgacaagattgattatatgttagaaactcaaatacttgaagta
catggtaggaatcaagtagatagtttaaccattttagataagaagaccaatcaaacttca
aactttaaagcagatggcttatttgttgccattggtatgaaaccaaacacgaagtttatt
aaagacttcgtaacactaaatgactatcatgaggtcatcgtaaatagtaaacaagaaact
aatatacctgggctatatgcagcaggtgatatggtagatcaaccccacaaacaaattatc
atagctgcagcagaaggtgcaaaagcagctatacatgcaaaccaatatttaaaattcaaa
ggagaataa

DBGET integrated database retrieval system