KEGG   Granulicella tundricola: AciX9_1662Help
Entry
AciX9_1662        CDS       T01411                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acm  Granulicella tundricola
Pathway
acm00564  Glycerophospholipid metabolism
acm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AciX9_1662
Enzymes [BR:acm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AciX9_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 3HCDH_N Pyr_redox HI0933_like Pyr_redox_3 NAD_binding_8 GIDA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADW68712
UniProt: E8WY85
LinkDB All DBs
Position
complement(1921445..1923040)
Genome map
AA seq 531 aa AA seqDB search
MNREEMIERVKARTTPWDIVIIGGGAVGAGVAVDAASRGLDVLLVEREDFGKGTSSRATK
LVHGGVRYLEQGNVSLVMEALKERGLLLQNAPHLVHDLPFVVPNYSWWEAPFYGIGMKIY
DLLAGKYGFGKSRVLSLAETLERLPTIQQEGLRGGVLYHDGQFDDTRLLTHLIVTAVDHG
ATVLNYASAVEMLKDSQDFLNAVIIEDRESGNRHTVGAKVVVNATGIFTDDTRRLANLVA
EPMVSPSQGIHLVFDRSFLAGDSAIMVPHTSDGRVLFAIPWHDRTLVGTTDTPIDKPSYE
PHALEEEIAFVLDTAAQYLSRPPTREDVLSIYVGIRPLVKAAGSDNSKTSALSRDHTIQI
DASGLITIVGGKWTTYRHMAEDCVNHAITLGDLPDTPCVTFNLHIHGYDQNASRLGSLAV
YGTDAAAIQQLIAAQPELGQLLHPDLPYIAAEIVWAARHEMSRSLDDALARRTRALLLNA
RATIAIAPKVAHLLAIELKRDATWEQAQVETFTKLATQYVLQPASAATVQP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgaagagatgatcgaacgcgtcaaggcccgcaccaccccatgggacatcgtc
atcatcggcggcggagcagtcggcgcaggcgtggcagtggatgccgcgtcgcgtggcctg
gacgtgctgctcgtggagcgtgaagacttcggcaaaggcacctccagccgcgcgacaaag
ctggtccacggcggcgtccgttacctcgaacaaggcaacgtctcgctggtcatggaagcc
ctcaaggaacgcggtctgctcctgcagaacgctccccatctcgttcacgatctccccttc
gtcgtgcccaactactcctggtgggaggcaccgttctacggcatcggcatgaagatctac
gatctcctcgccggcaagtacggcttcggcaaatcgcgcgtcctctcgctcgccgaaacc
ctcgaacgcctccccaccatccagcaggaaggcctgcgcggcggcgtcctttatcacgat
ggccagttcgacgacacccgtctcctcacccacctcatcgtcaccgccgtcgatcacggc
gccacagtcctcaactacgcatccgcagtcgagatgctcaaagactcccaggacttcctc
aacgcggtcatcatcgaagatcgcgaatccggcaatcgccacaccgtgggcgcaaaggtc
gtcgtcaacgccaccggcatcttcacggacgatacccgccgcctcgccaacctcgtcgcg
gagcccatggtcagccccagccagggcatccacctcgtcttcgatcgttccttcctcgcc
ggcgacagcgccatcatggtcccccacaccagcgatggccgcgtcctcttcgccatcccg
tggcacgaccgcaccctcgtcggtaccacggacacccccatcgataagccttcctacgag
ccacacgctctcgaagaagagatcgccttcgtactcgatacagccgcccaatatctcagc
cgcccgcccacgcgcgaggatgttctcagcatctacgtcggcatccgtcccctcgtcaaa
gccgccggctcggacaacagcaagacctccgccctctcccgcgatcacaccatccagatc
gacgcctcaggcctcatcaccatcgtcggcggcaaatggaccacctaccgccacatggca
gaggactgcgtcaaccacgccatcaccctgggcgatctcccggacaccccctgcgtcacc
ttcaacctgcacatccacggctatgaccagaacgccagccgcctcggctccctggccgtt
tacggcacagacgcagccgccatccagcaactcatcgccgcacagccggaactcggtcag
cttctccacccggacctgccttacatcgccgcggagatcgtctgggctgcacgccatgag
atgtcgcgttcgcttgacgacgccctagcccgccgcacccgcgcacttctgctcaacgcc
cgcgccaccatcgccatcgcccccaaagtcgcacaccttctcgccatcgaactgaagcga
gacgccacatgggagcaagcccaggtcgagactttcacgaaactagcaactcagtacgtc
cttcagcccgcatcagcagcgacggtgcagccatga

DBGET integrated database retrieval system