KEGG   Granulicella tundricola: AciX9_2884Help
Entry
AciX9_2884        CDS       T01411                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
acm  Granulicella tundricola
Pathway
acm00500  Starch and sucrose metabolism
acm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciX9_2884
Enzymes [BR:acm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AciX9_2884
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AciX9_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH
Motif
Other DBs
NCBI-ProteinID: ADW69907
UniProt: E8WYZ2
LinkDB All DBs
Position
3354880..3358512
Genome map
AA seq 1210 aa AA seqDB search
MKKLGSASDPLWYKDAIIYEIHVRAFADSNNDGIGDFPGLMSKLDYLQDLGVTCLWLLPF
FPSPLRDDGYDIANYVDVNPSYGTLNDFKLFIDAAHKRGMQVMIELVINHTSDQHPWFKA
ARLAPPGSPEREMYVWSETDLLYQGVRIIFTDTEKSNWTWDDQAKAFYWHRFFSHQPDLN
FDNPRVMEEVLKAMRFWLDLGVDALRLDAIPYLIERDGTNCENVPETHVKIKEIRAALDV
EYGNRLILAEANMWPADVRPYFGDGDECHMAFHFPLMPRIYMALRQEDRLPITDIMAQTP
DIPESCQWGLFLRNHDELTLEMVTDDERDYMYLAYSADPRMRINVGIRRRLAPLVDNNRR
RIELLNSLLLSFPGTPIMYYGDEIGMGDNIYLGDRNGVRTPMQWNSDRNAGFSKCDPARL
YFPVVMDPIYGYQVVNVEAQLSDQSSLLHWTRNMIALRKLFQVFGRGTLEFLHPENRKVL
AYLRDLKRDDGTHETVLCVANLSRFAQPVALDLTTYAGMMPVEMLGYVSFPQIGKTPYAL
TVAPYSFLWFELQPAPVEIEEPMDVTPGAREEGEQVALDLLTKGWAGLVSGPGATLLETA
LPGWLSRQRWFGAKTRTIQTVRIAEWVQIPAGAGEILPTSKLPAANTLGDALLFLDIVYA
DSSKDTYQLPISYTTGHAAEELRAAAPLSVIATLSTPTGSAMLHDASTREDLRQALLTMI
GDEATLALGNAASAGREIATTLIAAHTGRPAHEIGAKDTEVQEIAGKIAQEHSIEVADVA
PEFIGAMPGAENPSMTQVFGGAESASAANGAAGQLKAYKSSAFDAARGTAALPSRTGSAE
QSNTNFLYDQTLLMKLFRRLQPGLNPDVEIGRFLTEVAHFPRIAPFLGELTMVDSQGETT
TLAMLQGMVSNEGDGWQWTLEELARFYESVSACPIPANQGKLPRYGNEGVTPEDAKQHLG
LYLEAAALLGRRTAEMHLALATATDNAAFAAEAFTSEDLALDAKRIDTQISQTLEALKHG
MQALKDLTADDAATILSRRIELFSRAHAIAAGTPAGKRIRIHGDYHLGQILRAKNDFVIL
DFEGEPARTLEERRRKQSPLKDVAGMMRSFSYAAWSGLDQYALRHPDQARSFEPWARLWE
NSVATEFLRAYRQTMETDATLLPDAAQADSLLSAYLLEKALYELLYELNNRPTWVRIPLA
GILALPKPVA
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagctcggaagcgcaagcgatccgctctggtataaagacgcgatcatctatgag
attcacgtccgcgcctttgcggattccaataacgacggcatcggtgactttccggggttg
atgtccaagctggactatctccaggaccttggagtgacatgcctttggctgctgccgttc
ttcccttctccgctgcgggatgatggatacgacattgcgaactatgtcgatgtgaacccc
tcatacgggacgttgaacgacttcaagctgttcatcgacgcggcccataaacgcgggatg
caggtgatgatcgagctggtcatcaaccacaccagcgatcagcatccgtggttcaaggct
gcccggcttgcgccgccgggctcgcctgagcgcgagatgtatgtctggtccgagacggac
ctgctttatcagggcgttcgcatcatcttcacggatacggagaagtcgaattggacgtgg
gacgaccaggccaaggccttctattggcatcgcttcttctcccaccagcccgacctgaac
ttcgataacccacgcgtcatggaagaggtgctgaaggcgatgcgcttctggctggatctg
ggagtcgacgcgctgcggctggacgcgattccctatctcatcgaacgcgacggcactaac
tgcgagaacgtgccggagacacacgtcaagatcaaggagatccgcgctgcgctcgatgtc
gagtatggcaaccgcttgatcctcgccgaggcgaacatgtggccagccgatgtgcggcct
tacttcggcgatggcgacgagtgccacatggcgttccactttccgctgatgccgcgcatc
tacatggcgctccggcaggaggatcgtctgcccatcacggacatcatggcgcagacgccg
gatattcccgagagctgccagtggggcctgttcctgcgcaaccacgacgagttgacgctg
gagatggtgacggacgatgagcgggactacatgtacctggcttactcggccgacccgcgc
atgcggatcaacgtcggcatcaggcgtcgtctggctccactagtcgataacaaccgtcgg
cgtatcgagttgctgaactccctgctgctctcgttcccggggacgccgatcatgtactac
ggcgatgagatcggcatgggcgacaacatctacctgggcgaccgcaacggtgtacgtacg
ccgatgcagtggaactccgaccgcaatgcgggcttctccaaatgcgatccagcgcggctg
tactttcctgtcgtgatggacccgatctatgggtaccaggtggtgaacgtcgaggcgcag
ttgagcgatcaatcgtcgctgctgcactggacgcggaacatgatcgcgctgcgcaagtta
ttccaggtattcgggcgcgggacgctggagttcctgcacccggagaacagaaaggtactg
gcctacctgcgtgatctgaagcgcgacgatggcacgcatgagacagtcctgtgcgttgcg
aatctctcacgctttgcgcagcctgtggcgctggacctgacaacctacgcgggcatgatg
ccggtggagatgctgggctacgtatcgttcccgcagattgggaagactccgtatgcgttg
accgtagctccgtactcgttcctgtggtttgagctgcagcctgcacccgttgagatcgaa
gagccgatggatgtgacgccaggcgctcgcgaagagggcgagcaggtggcgctggatctg
ttgacgaagggttgggctgggctggtgtccgggccaggtgccacgctgctcgagacggcg
ctgccgggatggttgagccggcaacgttggttcggtgcgaagacgcggacgattcagacg
gtgaggattgcggagtgggtgcagattcctgctggcgctggagaaattttgccaacgtcc
aagctgcccgctgcgaacacgctgggggatgcgctgctgttcctcgacatcgtttatgcg
gacagctcgaaggatacgtatcagctaccgatctcctacacaacgggccatgcggctgag
gagcttcgcgctgccgcgccattgagcgtgattgcaacgttgagtacgccgaccggtagc
gccatgctgcatgatgcttccacgcgtgaggatctgcggcaggcattgctgacgatgatc
ggtgatgaagctacgctggcgctgggcaacgctgcttccgctggccgcgagattgcgacg
acgttgatcgcggcgcatacgggccggcctgcgcatgagattggcgcgaaggataccgag
gttcaggagatcgcgggcaagatcgcacaggagcacagcatcgaggttgcggatgtggct
ccggagtttatcggggccatgccaggcgcggagaatccctccatgacgcaggtgtttggc
ggcgctgagtctgcctctgctgcgaacggcgcggctgggcagttgaaggcttataagtcg
agcgcgttcgatgccgctcgagggactgctgcgctgccttcgcggacgggttccgcggag
caatcgaacacgaacttcctttacgaccagacgctgctgatgaagctgtttcgccgcctc
cagccggggctgaatccggatgtggagattggccgtttcctgacggaggtggcccacttc
ccgcgcatcgcaccgttcctgggtgagttgacgatggtcgacagccagggcgagacgacc
acgctggccatgctgcagggaatggtcagcaacgaaggagatggctggcagtggacgctg
gaggaactggcccggttttatgaatcggtgtccgcatgtccgattcccgcaaatcaaggc
aagctgccccgctacggcaatgagggcgtgacgccggaggatgcgaaacagcatcttggg
ctgtaccttgaagcggctgcactgctgggacgcagaacggcggagatgcatctggctctc
gcgaccgcaacggacaacgcagcgtttgcggccgaggcgtttacaagcgaggatctggct
ctggatgcgaagcggatcgatacgcagatcagccagacgctggaggctttgaagcacggg
atgcaggctctgaaggatctgaccgcggatgatgcggctacgatcctgagtcggcggatc
gagctgttctcacgcgctcatgcaattgctgcaggcacgccggccggcaagcgtatccgg
attcatggcgactaccacctgggtcagatcctgcgggcgaagaacgacttcgtcatcctg
gactttgagggtgagcctgcacgcacgcttgaggaacgcaggcgcaagcagtcgccgctg
aaggatgtggcgggcatgatgcggagcttctcctatgcggcctggtccgggctggaccag
tatgcgctacgtcacccggaccaggcacgatcgtttgagccctgggcgaggctgtgggag
aactcggttgccaccgagttcctgcgtgcttaccggcagacgatggagacggacgcgacg
ctgctgccggatgcggcgcaagcggattcgctgctgagcgcgtaccttctggagaaggcg
ctttacgagcttttgtatgaactgaacaatcggccaacctgggtgcgtattccgcttgcg
ggcatccttgcactgcctaaacctgttgcctga

DBGET integrated database retrieval system