KEGG   Anaplasma centrale: ACIS_00871Help
Entry
ACIS_00871        CDS       T01133                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
acn  Anaplasma centrale
Pathway
acn00970  Aminoacyl-tRNA biosynthesis
acn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACIS_00871 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acn03029]
    ACIS_00871 (gatB)
Enzymes [BR:acn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ACIS_00871 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ACIS_00871 (gatB)
Mitochondrial biogenesis [BR:acn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ACIS_00871 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ACZ49398
UniProt: D1ASE5
LinkDB All DBs
Position
complement(853203..854660)
Genome map
AA seq 485 aa AA seqDB search
MAANTGIIKGNTHEWEMVIGLEVHAQVISNSKLFSGASTGFCSEPNTQVALFDVAMPGTL
PVLNARCVEQAVRTSLALSCEVHKYSVFDRKNYFYPDLASGYQITQFYFPIATDGYITLD
ECCSKDVRISRIHLEQDAGKSMHVGDKTYLDFNRAGVALMEIVSAPDFRSPEEAAEYIKK
LRIILRAIGTCDGDMENGSLRCDANVSVRKVGDSNLGARSEIKNLNSIKHLAQAIRHEAC
RQVEVLESGGVVSQSTMLFDVDTCTTRSMREKEDACDYRYFPDPDLLPLELTTAFIDNIR
ASLPELPSEKKRRYMQDIGLSRYDADILSSDKDVSAYFESVVAKHAPDLAVPWITGELFG
ALNKRGSSIADSPVSAGRLVELLDLVADGTISGKMAKQVFALMFETEKSASDIVREQGLC
QITSEETLAPIVDRIISESPDEVAEYRQGKTKLLGYFVGKVMKETNGQANPGLVNTLIKR
RLAED
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcaaatactgggataattaagggaaacacccacgagtgggagatggttataggc
cttgaggtgcatgctcaggttatttcaaatagcaagctattctccggagcctctacgggt
ttttgttccgagcccaatacgcaggtagcgttgtttgacgtggcaatgccgggtactttg
ccggtgctgaacgcccgttgtgtggagcaggcggttaggacctcactggcgctctcttgc
gaagttcacaaatactcggtttttgaccgaaaaaattatttttatcctgatcttgcatct
ggctatcagataacgcaattctacttcccaatcgcaactgacgggtatatcacacttgac
gagtgttgtagtaaggacgtcaggatatccagaatccacctggagcaagatgccggtaag
agtatgcacgttggggataaaacctacctagattttaacagggctggggtggccctgatg
gaaattgtgtctgcacccgattttcgatctccggaagaggctgctgagtacatcaaaaaa
ctgcgtataatattgcgcgcaatagggacttgcgatggcgacatggaaaacggttccttg
cgttgtgacgcgaacgtttctgtcagaaaagttggtgatagcaatctgggtgcgaggtct
gagatcaaaaacctcaattctatcaagcatctggcccaagcaataaggcatgaggcgtgc
agacaggtggaggtgctcgagagcggtggggtagtcagccagagtaccatgttgttcgac
gttgatacgtgcactaccagatctatgcgcgagaaggaggatgcatgcgactaccgctat
tttccagacccggatttgttaccgttggagctcactacggcattcattgacaatatacgc
gcgtctctgcctgagcttccgtcggagaagaagcgtaggtatatgcaagacatcggccta
tcacggtacgacgcggatattttgtcttcggacaaggacgtgtcagcatattttgagtct
gtcgtagccaagcacgccccggatttggccgtgccgtggatcactggagaactttttggt
gcgttgaataaacgtgggtcaagcattgcggattcacccgtaagcgcgggacgtctggtg
gagctgttagacttggttgctgatggcacaatatctgggaaaatggccaagcaagttttt
gcgttgatgtttgaaacagaaaaatctgcctccgatatagtgcgtgagcagggcttgtgc
cagatcaccagtgaagaaactttggcccctatagtggatagaataataagtgagagcccc
gatgaggttgcggaatataggcagggcaaaacaaaacttttggggtactttgttgggaaa
gttatgaaggagaccaacggtcaggcaaacccggggcttgtgaatacattaataaaacgc
cgacttgccgaggactga

DBGET integrated database retrieval system