KEGG   Aminobacterium colombiense: Amico_0212Help
Entry
Amico_0212        CDS       T01202                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aco  Aminobacterium colombiense
Pathway
aco00473  D-Alanine metabolism
aco01100  Metabolic pathways
aco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Amico_0212
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Amico_0212
Enzymes [BR:aco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Amico_0212
Peptidoglycan biosynthesis and degradation proteins [BR:aco01011]
 Precursor biosynthesis
  Racemase
   Amico_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADE56358
UniProt: D5ECS6
LinkDB All DBs
Position
220932..222056
Genome map
AA seq 374 aa AA seqDB search
MSWRPTRLEVDLEKVRNNYRAIRKHVGESVRIFGVVKGDAYNLGADKIGRVLADMGVDFF
AVATGDEAISLRESGIESPILVLGPSPYGIAEEYVRLGIRAAINDKGIAKALSDASVRLQ
KPAYGHVKIDSGMGRIGFFPHEAADAVEEISHLPGLNLEGIFTHFAISDARDLTYTYEQH
STFVKVIGELEKRGITFSIKHCCNSGATLALPQFVMDGVRPGQLVVGMYPSKEVVRSIAI
EPVFEFKTAISAIRTVPAGKKLSYGLTYETTADERIAVIPVGYHDGYSRELSGKGTEVLI
HGKRCPIVGRICMDQALVDVSVLQNPQIGDEVVLLGKQGEETITGDEIADKIGTIFTTLP
NMIGKRVPRVYLNE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggagacctaccagattggaagttgaccttgagaaggtcagaaataactatcgg
gcaatacgaaagcatgtgggagagagcgttaggatctttggcgttgtaaaaggtgacgcc
tataacctcggagcagataaaataggcagggttttggcagatatgggggtagacttcttt
gcggttgccactggtgatgaggccatttccttaagggaatcgggcattgaatcccctata
ctggtgctggggccttctccgtatggcattgctgaagaatatgttcgtttagggataaga
gctgccattaatgataaaggaatagctaaggctctgtcagatgcatctgtcagacttcag
aaacctgcatatggccatgtcaagatagattccggcatgggaagaataggctttttccct
catgaggcggcagatgcggtagaagagatctctcatttgccagggcttaacctggagggg
atctttacccattttgccatttcagatgcaagggatctaacatacacttatgaacagcat
tccacctttgtaaaagttattggcgagcttgaaaagcggggcattactttttctataaaa
cattgctgcaattctggcgctactcttgcgctgccccagtttgttatggacggcgtaagg
ccaggacagcttgtagtgggtatgtacccgtcaaaagaagtggtacgttctatcgccata
gagcctgttttcgagtttaaaacagccatatcagcaattcgtaccgtgccagccggaaaa
aaactcagctatggtttgacatatgaaactacagcagatgaaagaatcgctgttataccg
gtggggtatcatgacggctattccagagagctctcaggaaaaggtacggaagtgttaata
cacgggaaacgatgtcccatagtggggcggatatgtatggaccaggctctggtggatgta
agcgttcttcagaacccccaaataggagacgaagtcgttctccttggaaagcagggagaa
gaaacgatcacaggggatgagatcgctgacaagatcggaaccatcttcacaaccctcccc
aacatgataggtaaaagagtgccgagagtgtatttgaacgaataa

DBGET integrated database retrieval system