KEGG   Aminobacterium colombiense: Amico_1315Help
Entry
Amico_1315        CDS       T01202                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
aco  Aminobacterium colombiense
Pathway
aco00010  Glycolysis / Gluconeogenesis
aco00020  Citrate cycle (TCA cycle)
aco00620  Pyruvate metabolism
aco00640  Propanoate metabolism
aco00650  Butanoate metabolism
aco00680  Methane metabolism
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01120  Microbial metabolism in diverse environments
aco01130  Biosynthesis of antibiotics
aco01200  Carbon metabolism
Module
aco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_1315
   00020 Citrate cycle (TCA cycle)
    Amico_1315
   00620 Pyruvate metabolism
    Amico_1315
   00640 Propanoate metabolism
    Amico_1315
   00650 Butanoate metabolism
    Amico_1315
  09102 Energy metabolism
   00680 Methane metabolism
    Amico_1315
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Amico_1315
Enzymes [BR:aco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Amico_1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADE57433
UniProt: D5EFV1
LinkDB All DBs
Position
1336481..1337647
Genome map
AA seq 388 aa AA seqDB search
MPRKEITSGNWAFAEAMRQINPDVVAAYPITPSTDIIMKFAEFVANGEVDTNFVTVESEH
SAITACVTASAAGARVMTASSANGVALMHEIFPIAGCFRTPIVFGLVNRSVGAPINIHCD
HSDSMAQRDYGWIHLYCEDAQEVYDSAFMAIRLSENNDVLTPVFVCQDGFITSHGFEPVE
YLDDETVKKFIGERTPINPLLDIENPVTYGSFAMSEYYFEIKRQQIEANKKALELYDGIA
KEYEAISGRYYPMIDCYKTDDADYVIVVMSSASGAVKDVVDEMREKGHKVGCLRIRMFRP
FPTEAIAAALKGKKAVAVLDRSLSLGGTAPLAAEVRSALYAAGELIPTNSCIYGLGGRDF
FPQYAENIFMDLINGNISPEEHYIGLLE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtaaagaaattacatcaggaaactgggcttttgctgaagcaatgcgccagata
aatccggacgtcgttgcggcatatcccatcacgccttcaacagatatcatcatgaaattc
gcagaatttgtagccaacggcgaggtcgacacaaactttgttacagtagaaagtgagcac
tctgccatcactgcctgtgtaacggcctcagctgcgggagctcgtgtcatgacagcttca
agcgcaaatggcgtagcgctcatgcacgaaatattccctattgcgggttgcttcagaacc
cccatagtctttgggctagtgaacagaagcgtaggagcccccataaatatccactgcgac
cacagcgatagcatggcccaacgggattatgggtggatacacctatactgcgaagatgct
caggaagtatacgattcagcctttatggccatacggctcagtgagaacaatgatgttctt
actcccgtatttgtctgccaggacggctttattaccagccatggtttcgaacctgtggag
tacctggacgatgaaactgtaaagaaattcattggagaacggacccccataaacccattg
cttgatattgaaaatccagtaacatacggatcctttgccatgtccgagtattattttgag
atcaagcgtcagcagatcgaagcaaacaaaaaagcccttgagctttatgacggaattgca
aaggaatatgaagccatatctggccgctactaccccatgatcgactgctacaaaaccgat
gatgccgattacgtaattgttgtcatgtcctctgcatcaggagcagtgaaagatgtggta
gatgaaatgagggaaaagggacacaaggtagggtgccttcgtattcgcatgttccgcccc
ttccccactgaagcaatagctgctgcccttaagggtaaaaaagcggttgctgttcttgac
agaagcctgagcttaggcggaaccgcgccacttgcggcagaggtcagaagcgccctctac
gctgccggagaattaatccccaccaacagctgcatatatggccttggcggaagggatttc
ttcccacagtatgctgagaatatctttatggacctcataaatggcaacatttcgcccgaa
gagcactacatcggccttctagaatag

DBGET integrated database retrieval system