KEGG   Aminobacterium colombiense: Amico_1873Help
Entry
Amico_1873        CDS       T01202                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
aco  Aminobacterium colombiense
Pathway
aco00030  Pentose phosphate pathway
aco01100  Metabolic pathways
aco01120  Microbial metabolism in diverse environments
aco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Amico_1873
Enzymes [BR:aco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Amico_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADE57986
UniProt: D5EHF4
LinkDB All DBs
Position
1931073..1932875
Genome map
AA seq 600 aa AA seqDB search
MEGRFGAILRVDLSSRKMTKEALDERLLRNYIGGRGYASKVLYDENPPNVDPLSPENRLI
IATGPLTGRAAPAAGRYMVVTKSPLTGYIASSNSGGFWGAELAKTGWFMLIIEGKADRPV
YINIRDDQVEIRDGSHLWGQNTYIATDQILEDIQDPKARVLCIGPAGEHLSPIASIMNEK
NRAAGRSGVGAVMGSKNLKAIAVRGTSRPYVANSEEFSAVLKERAAKLKAHPVTSQGLPA
YGTAILVNIINQTGAYPYRNWQGAYMEDADKQSGETLAAKYLTDNYHCFGCPIGCGRITK
VNDIAGEGPEYESIFALGACCGIAPIEPIIMANYTCNEYGLDTISTGVTIAAAMELYEKG
YIKKEELESGPDLTFGNTEALVYWIEKMGKGEGLGKKLALGSWRLCDMYGHPELSMTVKK
QEMPAYDARAIQGIGLTYAVSNRGACHVRGYLISPEILGSPEKLDPDDISKKPLWGKIFH
DLTAAIDSSGMCLFTSFALDAADYAAFLKAGTGFDYSADEIMTCGDRIWNLERLFNLREG
LDPKTEDTLPPRLLKEPIPEGPGKGKLSRVPEMLPEYYQLRGWDEKGVPSQETLERLGLL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggaaggccgttttggcgccattttgcgagtagacctgtcttctcgtaaaatgacaaaa
gaagctttggacgaaaggctccttcgtaattatatcggaggccgcggctatgcctccaaa
gtcctttacgatgaaaatcctcccaatgttgatccactgagcccagaaaaccgcctcatc
atcgcaaccggacctttaacgggacgagcagcacctgctgcaggccgatatatggttgtt
accaaaagccccctcaccggctatattgcatcaagcaattccgggggattctggggagcc
gagctggctaaaaccggctggttcatgcttattattgaaggaaaagctgatcgtccagtc
tacattaacatccgcgatgatcaggtggagattcgggatggaagccacctttggggacaa
aacacctacatcgccaccgatcaaatcctcgaggacattcaagacccaaaggccagggtc
ctctgcatcggtccggcaggagagcatctttcccccattgcgtccataatgaacgaaaag
aacagagccgctgggcgaagcggagtaggcgcagttatgggatcaaaaaaccttaaagcc
atcgccgtgcgaggaacatcccgaccctatgtcgccaactctgaagaattctctgctgtg
ttaaaagaaagagcagccaaactcaaggctcatcctgtcacaagtcaaggattgccggcc
tatggaacagccatattggtgaatatcatcaaccagaccggggcctacccttaccgcaac
tggcaaggagcctatatggaggacgctgataaacaatctggagaaactcttgcagcaaaa
tatctaacagacaattaccactgctttggttgtcctattggctgtggacgtattacaaag
gttaacgatatagccggagaagggccagagtacgaaagtatcttcgcccttggcgcatgc
tgcggcatcgcgcctatcgaacccataataatggccaactatacttgcaatgaatacgga
cttgacaccataagcacaggcgtcaccatagcagctgccatggagctatatgaaaaagga
tacatcaaaaaggaggagcttgaaagcggtcccgatctcacctttggcaatacagaagcc
ctcgtgtattggatagagaaaatgggaaaaggggaggggcttggcaaaaaacttgccctt
ggctcctggcgtctctgtgacatgtacggacatcccgaactgtccatgacagtaaaaaag
caggaaatgccagcctatgatgccagagctatccagggaatcgggctgacttatgccgta
agcaaccgtggagcttgccacgtacgagggtacctcatctccccagaaattctcggatca
cccgaaaaactagaccctgacgatatttcgaaaaaacccttgtggggaaaaatctttcac
gatctcaccgctgccatcgattcttcgggaatgtgcctctttacatcctttgctcttgat
gccgcagattacgccgcttttttgaaagcagggacagggtttgactattctgcggacgaa
atcatgacgtgcggagaccgaatatggaacctcgagcgccttttcaatttaagagaaggg
cttgatcccaagactgaagacactcttccgccgcgacttttgaaagaacctatccccgaa
gggccaggaaaggggaagttaagcagagttccggaaatgcttcctgaatattatcagctg
cggggctgggatgaaaagggagttccttcccaggagaccctggagcgtcttgggctcctg
taa

DBGET integrated database retrieval system