KEGG   Azoarcus communis: CEW83_05310Help
Entry
CEW83_05310       CDS       T05456                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
acom  Azoarcus communis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase HDOD Pkinase_Tyr APH GAF_3 GAF TadZ_N zf-met2 Kdo
Motif
Other DBs
NCBI-ProteinID: AWI74700
UniProt: A0A2U8GML3
LinkDB All DBs
Position
complement(1147842..1150223)
Genome map
AA seq 793 aa AA seqDB search
MTNAIGRFELQRELGRGAQSVVFLAFDPQLEREVAVKTVHFSEKRAAMGEALLAEARSVS
RLRHPGIVPIFEAGEFAGDPYLVFEYVPGESLARFMKREGVVEPARAAGLMVRILAAIAA
AHAEGVIHRDLKPGNVLMDGGGTPRVMDFGIARRLAGGKGVAGAFSGTPAYMAPEYILER
EVSARGDVFAAGVILVEMLLGRRLFVGDDIDAVMRKVATESVVLPDDCGLDERLVGIALR
AVSRDPATRYQTATEFEQALQGWLAPLEEAPPSGGSQSTVEFLLRRMRHKSDFPALSESV
GAINRIAGSESESINKLSSLILRDFSLTNKLLRLVNSVYYHQAGAGNISTISRAVLVLGF
DAVRNIAITVLLFEHLQNKHNASQLKEAFLRANLAALLARELAVRLRSRDLEQAYICSMF
HGLGRLLSQFYFPDESEEIRRLVTQKECGEDAAVHRVLGISFDELGVGIARSWGFPALIV
DSMHRLPTGAVRKPATNEERLRVLAGFSNEICSALALVDPEQRERELQCTAARFGDALPA
AEFDLRETVNASIEQLTDFSRIIRINLHQTQFGQQLKKFSRSKGTAHGEDEDEGAASEAA
AVSKGGSGGTIPSGVFDADGLRVDTETVLSAGIQDISNTLVEDFKLNDVLRIILETMYRA
IGFRRVLLCIRDARSNTMQGRFGLGPEVSELARKFCFPLSFTPDIFHVATSKGADILISD
VNDPGIADRIPGWFRDSVQASTFVLLPLTIKQKPVALIYADKDHAGEIVISERELSLLKT
LRNQAVLAIKQSS
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgcaatcggacgcttcgaactgcagcgagaactcgggcgcggtgcgcagagc
gtggtatttctcgccttcgatccccagctcgagcgcgaagtggcggtgaaaacggtacat
ttcagcgagaagcgtgccgccatgggcgaagccctgctcgccgaggctcgcagcgtcagc
cgtctgcgccacccggggatcgtgcccatcttcgaggccggggagtttgccggcgaccct
tacctggtgttcgagtatgtgccgggagagagccttgcccgcttcatgaaacgagagggc
gtggtcgagcccgcccgtgccgcagggctgatggtgcggattctcgcggccatcgctgcc
gcgcatgcggaaggggtgatccaccgcgacctgaagccgggcaacgtgctgatggacggt
ggtggcacgccaagggtgatggactttggcattgcccgtcggttggcgggcggcaaaggc
gttgcaggcgcgttctccggcacgccggcctacatggcgccggagtacattctcgagcgt
gaggtgagtgcgcgcggggacgtgttcgccgccggggtgatcctggtcgagatgctgctc
gggcgcagactgttcgttggcgacgacattgatgcggtgatgcgcaaggtggccacggag
tcggtcgttctgcccgacgactgcgggctggacgagcgcctggtcgggattgcattgcgc
gcggtttcacgcgatccggcgacgcgctaccagaccgcgaccgagttcgagcaggcgctg
cagggctggctcgcgcctctggaagaagcgccgccctcgggcggaagccagagcacggtg
gagttcttgttgcggcgcatgcgacacaagagcgatttcccggcactgtccgagtcggtc
ggggcgatcaatcgcattgccggcagcgaatccgaaagcatcaacaagctgtcttccctg
atcctgcgcgacttctcgctgaccaacaagctgctgcgcctggtcaattcggtctattac
catcaggccggggcaggcaatatcagcacgatctcgcgggcggttctggtgctcggtttc
gatgcggtacgcaacatcgcgatcaccgtgctcctgttcgaacacctgcagaacaagcac
aacgccagccagctcaaggaagcgttcctgcgcgccaatcttgcggcgctgcttgcgcgc
gagctggcggtcagactgcgttcgcgcgatctggagcaggcgtatatctgctcgatgttc
cacggtctgggccgtctgctgtcgcagttctactttccggacgagagcgaggagatccgg
cgtctggttacacagaaggagtgtggcgaggatgcggccgtgcatcgtgtgctgggcatc
agcttcgatgagcttggtgtcgggatcgcccgcagctggggttttcctgcgttgatcgtt
gacagcatgcatcgtctgccgacgggcgctgtgcgcaagccggcgacgaacgaggagcga
ttgcgcgtgctggcgggattctcgaacgagatctgctctgcgctcgcgctggtcgatccg
gagcagcgcgaacgcgagctccagtgcactgccgcacgctttggcgatgccttgccggcg
gccgagttcgatttgcgggagaccgtcaatgcctcgatcgagcagctgaccgatttttcc
cgcatcatccgtatcaacctgcaccagacccagttcggccagcagctgaagaagttcagc
cgcagcaaggggacggcccatggcgaagatgaggacgagggcgcagcgagcgaggctgcc
gccgtcagcaagggtggctcaggtggcaccataccctcaggcgtgttcgacgcggacggg
ctgcgggtggataccgagaccgtactgtcggccggaattcaggacatcagcaacaccctg
gtcgaagacttcaaacttaacgatgtgctgcgcatcatcctcgagacgatgtatcgcgcg
atcggcttcaggcgcgtattgctgtgcatccgggacgctcgcagcaacaccatgcagggg
cggttcggactggggccggaggtgtccgagctggcgaggaagttctgcttcccgctcagc
ttcacgcccgacatctttcacgtcgccacctcaaagggcgccgacatcctgatttcggat
gtgaacgatccggggattgccgatcgcatcccgggctggttccgggactcggtgcaggcg
tccacctttgtgctgctgccgctcacgatcaagcagaaaccggtggccctgatctacgcc
gacaaggatcacgccggtgaaatcgtgatctcggagcgcgagctgtcgctgctgaaaacc
ctgcgcaaccaggcggtgctcgcgatcaagcagtcaagctga

DBGET integrated database retrieval system