KEGG   Azoarcus communis: CEW83_09225Help
Entry
CEW83_09225       CDS       T05456                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
acom  Azoarcus communis
Pathway
acom00030  Pentose phosphate pathway
acom01100  Metabolic pathways
acom01120  Microbial metabolism in diverse environments
acom01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CEW83_09225
Enzymes [BR:acom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CEW83_09225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AWI75372
UniProt: A0A2U8GNZ9
LinkDB All DBs
Position
complement(2027358..2029205)
Genome map
AA seq 615 aa AA seqDB search
MGWNRKVLRVDLTAGTCKEEPLNMKWAQEYLGSRGLATKYLVSEIDPKVDPLSPDNKMIM
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGYFGAELKFAGWDMIIFEGKSPKPVY
LYIENDKAELRDAGHLWGRSCWETEETIKHELQDPLVRVSSIGLAGENEVMFACVVNDLH
RAAGRSGVGAVMGSKNLKAVALRGTKGVSGIHDFKAFMKATTDAKKVLADNAVTGQGLPK
YGTQVLMNVINEMGALPTRNHRDVQFEDAGKISAEAMHEKRESDGKSQLVTNAACFGCTI
ACGRISEIDKGHFTVKNSPKYWGASGGLEYEAAWALGAANGVGDIEALQYANMICNEQGM
DPISFGATVGAVMELYDMGVLDSAKIGIDSPFGSAEALAKLVEMTANGEGFGKEIGLGSK
RLCEKYGHPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPLTTEGKPELVKAFQDATAVFDSAGICVFTSFAWTLADVQPQLDAACEGDWSMDKLNE
VGERIWNMEREFNNAAGFTAKDDNLPPRLTTEPAKTGPAKGLVNGLATMLPEYYKARGWT
PDGVPTAETKARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggctggaacagaaaagtcctgcgtgtcgatctgacggcaggcacctgcaaggaagag
ccgctgaacatgaagtgggctcaggaatacctgggctcgcgcggtctggcgaccaagtac
ctggtatcggagatcgatcccaaggtcgatccgctgtcacccgacaacaagatgatcatg
gccaccggtccgctgaccggcaccatggcctcgaccggcgggcgctatacggtggtgacc
aaggggccgctgacgggggccatcgcgtgctcgaattcgggcggctacttcggcgccgaa
ctcaagttcgccggctgggacatgatcatcttcgagggcaagtcgcccaagccggtctat
ctctacatcgagaacgacaaggccgagttgcgcgacgccggacatctctggggccgcagc
tgctgggagaccgaagaaacgatcaagcacgagctgcaggatccgctggtgcgcgtgtcg
tcgatcggcctcgcgggagagaacgaggtgatgttcgcctgtgtggtgaacgacctgcac
cgtgcagcagggcgctccggcgtgggcgcggtgatgggctcgaagaacctcaaggcagtc
gcactgcgcggcaccaagggcgtgtccggcattcacgacttcaaggccttcatgaaggcg
accaccgacgccaagaaggtgctggcggataacgcggtgaccggccagggactgcccaag
tacggcacccaggtgctgatgaacgtgatcaacgagatgggcgcgctgcccacccgcaat
caccgcgacgtgcagttcgaggacgccggcaagatctccgccgaggcgatgcacgagaaa
cgcgagagcgacggcaagtcgcagctggtgaccaatgccgcgtgtttcggctgcaccatc
gcctgcggtcgcatctcggaaatcgacaagggccacttcaccgtcaagaacagtcccaag
tactggggggcgtccggcggtctggagtacgaggccgcctgggcactgggggcagccaac
ggcgtgggcgatatcgaggccctgcagtacgccaacatgatctgcaacgagcagggcatg
gacccgatctccttcggcgcgaccgtgggtgcggtgatggagctgtacgacatgggcgtg
ctcgattcggccaagatcggcatcgattcgcccttcggctctgccgaggcgctggcgaag
ctggtggagatgacggcaaatggcgagggctttggcaaggagatcggcctcggctccaag
cgcctgtgcgaaaagtacggtcatcccgagctgtcgatgagcgtgaagggccaggaattc
ccggcctacgattcgcgcggcatccagggcatgggcctggcctacgccacctcgaaccgc
ggcgcctgccatttgcgcggctacaccgtggcctccgaagtgctcggcattccggtcaag
accgatccgctcaccaccgagggcaagccggagctggtcaaggcgttccaggatgccacc
gcagtgttcgactctgccggcatctgcgtcttcaccagctttgcgtggaccctggccgat
gtgcagccccagctcgacgccgcctgcgagggcgactggagcatggacaagctcaacgag
gtgggcgagcgcatctggaacatggagcgcgagttcaacaacgctgccggcttcaccgcc
aaggacgacaacctgccgccgcgcttgaccaccgagccggccaagaccggtccggccaag
gggctggtcaatgggctggcgaccatgctgccggagtactacaaggcgcgtggctggacg
cctgacggtgtgccgaccgctgagaccaaggcccgcctggggctgtaa

DBGET integrated database retrieval system