KEGG   Azoarcus communis: CEW83_09615Help
Entry
CEW83_09615       CDS       T05456                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
acom  Azoarcus communis
Pathway
acom00020  Citrate cycle (TCA cycle)
acom00480  Glutathione metabolism
acom01100  Metabolic pathways
acom01110  Biosynthesis of secondary metabolites
acom01120  Microbial metabolism in diverse environments
acom01130  Biosynthesis of antibiotics
acom01200  Carbon metabolism
acom01210  2-Oxocarboxylic acid metabolism
acom01230  Biosynthesis of amino acids
Module
acom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acom_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEW83_09615
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CEW83_09615
Enzymes [BR:acom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CEW83_09615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AWI75438
LinkDB All DBs
Position
2113164..2115401
Genome map
AA seq 745 aa AA seqDB search
MVAGKSKIIYTLTDEAPMLATCAFLPIIRTFTGPAGIEIAKSDISVSARILSEFSDYLTE
EQKVPNALAELARLTQEPDTNIIKLPNISASVSQLSAAIKELQTRGFKIPDFPENPKTDE
EKAIKARYGKCLGSAVNPVLREGNSDRRAPAAVKSYARKNPHSMQPWSQASRTHVSHMKH
GDFYHGEKSMTLDRARDVKMELTTKSGKNIVLKPKISLLDGEIIDSMFMSKKALCDFYEE
QIEDARKTGVLFSLHVKATMMKVSHPIVFGHCVRIYYRDAFEKHAALFEELGVNVNNGMV
NLYDKIATLPESKRDEIIRDLHACHEHRPELAMVDSAKGITNFHSPNDIIVDASMPAMIR
SGGKMWGTDGKQYDCKAVMPESTFARIYQEMINFCKTNGNFDPTTMGTVPNVGLMAQQAE
EYGSHDKTFEIQEAGVANIVDLETGEVLLSQDVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVEKYLKDHDTTGLDIQHMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEELGIKTGNDKAKVLAKTLDSATGKLLDNNKSPSPRTGELDNR
GSQFYLAMYWAQALAEQNDNAELKAHFGPIAKSMTENEQKIIDELKSVQGQPVDIGGYYL
ADSDKCKAVMRPSATLNELLKAARV
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagggaaatcgaagatcatctacacgctcacggacgaagcgccgatgctggcc
acgtgtgctttcctacccattatccggaccttcaccggccccgcaggcatcgagatcgcc
aagagcgacatctcggtgtcggcccgcatcctgtctgaattttccgactatctgaccgaa
gagcagaaagtgccgaacgcgctggccgagctcgctcgcctgacgcaggaaccggacacc
aacatcatcaagctgcccaacatcagcgcctcggtgtcgcagctgagcgcagcaatcaag
gagctgcagacgcgcggcttcaagattcccgatttccccgaaaatccgaagaccgacgaa
gaaaaggcgatcaaggcacgttacggcaagtgcctcggctcggcggtaaacccggtgctg
cgtgaaggcaactccgaccgtcgcgcccccgctgcggtcaagagctacgcgcgcaagaac
ccgcattcgatgcagccctggagccaggcctcgcgcacccacgtgtcgcacatgaagcac
ggcgacttctatcacggcgaaaagtccatgaccctggaccgcgcccgtgacgtgaagatg
gagctgacgaccaagagcggcaagaacatcgtgctcaagccgaagatttcgctgctcgac
ggcgagatcatcgacagcatgttcatgagcaagaaggcactgtgcgacttctacgaagag
cagatcgaagatgcgcgcaagaccggcgtcctgttctcgctgcacgtgaaggcgacgatg
atgaaggtctcgcaccccatcgtcttcggccactgcgtccgcatctactaccgtgacgct
ttcgagaagcacgccgcactgttcgaagagctgggcgtgaacgtgaacaacggcatggtc
aatctgtacgacaagattgcaaccctgcccgagtccaagcgcgacgaaatcatccgcgac
ctgcacgcctgccacgagcaccgccccgaactggcgatggtcgattcggccaagggcatc
accaacttccactcgccgaacgacatcatcgtcgacgcgtcgatgccggcgatgatccgc
tccggcggcaagatgtggggcactgacggcaagcagtacgactgcaaggccgtgatgccg
gaatccaccttcgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcaac
ttcgacccgaccaccatgggcaccgtgcccaacgtcggtctgatggcgcagcaggccgaa
gagtacggctcgcacgacaagacgtttgagattcaggaagcaggcgttgccaacatcgtc
gacctcgaaaccggcgaagtgctgctgtcgcaggacgtcgaagagggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtgaagctggccgtgacccgtgcc
cgcaactccggcatgcccgcgatcttctggctcgacccctatcgtccgcacgagaacgag
ctgatcaagaaggtcgaaaagtacctgaaggatcacgacaccaccggtctggacatccag
cacatgtcgcaggtccgcgccatgcgttacacgctggagcgcgtcgtccgcggtctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactcggcaccagcgccaagatgctctccatcgttccgctgatggctggcggcggcatg
tacgaaaccggcgccggcggctccgcaccgaagcacgtcaagcagctggtcgaagagaac
cacctgcgctgggattcgctgggcgaattcctggcactggcggtgtcgctcgaagagctg
ggcatcaagaccggcaacgacaaggccaaggtgctcgccaagacgctcgacagtgcgacc
ggcaagctgctcgacaacaacaagtcgccctcgccccgtaccggcgaactcgacaaccgc
ggcagccagttctacctcgcgatgtactgggcacaggcactggccgagcagaacgacaat
gccgaactgaaggcgcactttggcccgatcgcgaaatcgatgaccgagaacgaacagaag
atcatcgacgagctgaagtcggttcagggtcagccggtcgatatcggcggctactacctc
gccgactccgacaagtgcaaggcggtcatgcgcccgagcgcaaccctcaacgaactgttg
aaggctgcacgcgtgtaa

DBGET integrated database retrieval system