KEGG   Azoarcus communis: CEW83_09925Help
Entry
CEW83_09925       CDS       T05456                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acom  Azoarcus communis
Pathway
acom00564  Glycerophospholipid metabolism
acom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CEW83_09925
Enzymes [BR:acom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CEW83_09925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 FAD_binding_3 NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox 3HCDH_N Thi4
Motif
Other DBs
NCBI-ProteinID: AWI75491
UniProt: A0A2U8GPF7
LinkDB All DBs
Position
complement(2183081..2184649)
Genome map
AA seq 522 aa AA seqDB search
MTASAKSGLAERARQALLVRLSEPRVWDVVVIGGGATGLGCAVDAAARGYSVLVVDAEDF
AKGTSSRATKLIHGGVRYLAQGNLPLVREALAERARLLENAPHLVHPLRFVVPAYRLHDK
PMLAAGLGLYDLLAGRRGIARSKVLNVDDTLAALVTVKRDGLRGGIAYWDAQFDDARLAL
TLARTVGDFGGLAVNYCAATGLAIEGGKVCGVDLRDVESGQAYRVGARVVINASGVWADS
VRRLARADAHDMLSPSQGVHLVVDRAFLPGEDALLVPHTDDGRVLFMIPWQGKVLLGTTD
SPRSDLPLEPRPLPGEIDFILETAARYLERPPSRADVRAVFVGLRPLIGGGRDSPTRQLS
REHLVDVSAEGLVSVTGGKWTTYRVMAEDAIDAAQPVGGLPQRSSATARLRLHGAPEKSD
GDVYGLDRKDVLRLPGADNILAEGLTLTEAEVRYAARAEFARTVEDVLARRHRALFFDAE
AAVRAAPAVAAILAEELGRAPDWAAAEVDRFRALAAQYQVGP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgtcggcgaagagcggtctggccgaacgggcgcggcaggccttgctggtccgg
ctgtcggagcccagagtatgggacgtggtcgtgattggcggcggggcaaccgggctgggc
tgcgcagtcgacgctgccgcgcgcggatattcggtgctggtcgtggatgcagaggatttt
gccaagggtacgagctcgcgtgcgaccaagctgattcacggcggcgtgcgctatctcgcg
cagggcaacctgccgctggtgcgggaagcattggccgaacgcgcccgtctgctcgagaac
gccccccatctggtccatcctctgcgctttgtcgtgcctgcataccggctgcacgacaaa
ccgatgctcgcggccgggctcggcctgtacgacctgctggccggccgccgcggcattgcc
cgcagcaaggtgctgaacgtcgacgacacgcttgccgcgctggtcactgtaaagcgtgat
ggtttgcgcggcggaatcgcctactgggacgcccagttcgacgatgcgcggctggccctg
accctggcgcgcaccgtaggcgatttcggcggtctggcagtgaattactgtgccgcgacg
gggcttgcaatcgaaggcgggaaggtctgcggggtggatctgcgcgatgtggagagcggg
caggcatatcgcgttggcgccagggtggtgatcaatgcgtccggggtgtgggccgacagc
gtgcgccgcctggcgcgggctgacgcccatgacatgctcagccccagtcagggtgtgcat
ctggtcgtggatcgcgcgttcctgcccggtgaggacgcgctgctggtgccgcataccgac
gatggccgcgtgctgttcatgattccctggcaggggaaggtgctgctgggcaccaccgac
tcgccgcgcagcgatctgcctctcgagccacggcccctgccgggcgagatcgacttcatc
ctggagaccgcagcacgctatcttgaacgccctccatcccgtgcggatgtacgcgcggtc
ttcgtcggcctgaggcccctcatcggagggggccgtgactcccccacgcgacagttgtca
cgtgagcatcttgtggacgtctcggccgagggactggtcagcgtcaccggtggaaaatgg
acgacttatcgagtgatggccgaggatgcaatcgatgccgcacagccggttggcgggctg
ccgcagcgttcttcggcgactgcccgtctgcgtttgcatggtgcgccggagaagagtgat
ggcgatgtctatgggctcgatcgcaaggacgtgctgcgcctgcccggcgcggacaacatc
cttgcagaagggctgacgctgaccgaagccgaggtccgatatgctgcacgcgccgaattc
gcgcgcacggttgaagatgtccttgcccgtcgccatcgggcgctgttcttcgatgctgaa
gcggcggttcgcgccgcacctgcggttgcagcgattctggccgaagagcttggaagggcg
ccggactgggccgcggcagaagtcgatcgcttcagggcgctggctgcgcagtatcaggtc
ggcccgtga

DBGET integrated database retrieval system