KEGG   Azoarcus communis: CEW83_11090Help
Entry
CEW83_11090       CDS       T05456                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acom  Azoarcus communis
Brite
KEGG Orthology (KO) [BR:acom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CEW83_11090
Enzymes [BR:acom01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CEW83_11090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C Thi4 FMO-like K_oxygenase Glutaredoxin Lycopene_cycl NAD_binding_8 NAD_binding_9 dsrm
Motif
Other DBs
NCBI-ProteinID: AWI77653
UniProt: A0A2U8GWL5
LinkDB All DBs
Position
complement(2433208..2434761)
Genome map
AA seq 517 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDGEKSREMQALIKDVAEQSDLISVIERRDDTE
RKPSFSVGPKGGEARVRFAGLPMGHEFTSLILALLQSAGYPPKVEADVIEQIKNIEGEYN
FETYISLSCHNCPDVVQALNLLSILNPNIRHTMIDGALFQGEVEERKIMAVPTVYLNGQE
FGQGRMELAEIIGKIDTGAEKREAAKIAAKDAFDVLIVGGGPAGAAAAIYSARKGIRTGI
VAERFGGQVMDTMGIENFISVKETQGPKLVAALEEHVKQYDVDIMNLQRAAKLVPGDMTE
VQLENGASLKAKTVILATGARWREMNVPGEQAFRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQKKLYSLPNVTVIKSAQTTEVTGTDKVN
GLMYKDRSTDEVKRIELEGIFVQIGLLPNTDFMKGAIELSRFGEVIVDAKGQTSVPGIFA
AGDCTTVPYKQIIIAMGEGSKAALSAFDHLIRSSVEA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatatcaagactcaactgaaagcctatctggaaagggtgacgcagccg
atcgagatcgtggcgtcgctggacgatggcgaaaagtcgcgcgaaatgcaggcgctgatc
aaggatgtcgccgaacagtcggatctcatcagcgtcatcgagcggcgcgacgacaccgaa
cgcaagccctccttctcggtcggtcccaagggcggagaggcgcgcgtgcgctttgccggc
ctgccgatggggcatgaattcacctccctcatccttgccctgctgcagagcgcgggctac
ccgcccaaggtcgaggcggatgtgatcgagcagatcaagaacatcgagggcgaatacaac
ttcgagacctacatctcgctgtcctgccacaactgcccggacgtagtgcaggcgctcaac
ctgctctccatcctcaatccgaacatccgccacaccatgatcgatggcgccctgttccag
ggcgaagtggaagagcggaagatcatggccgtgcccacggtctacctgaacggtcaggaa
tttggccagggtcgcatggagctggccgagatcatcggcaagatcgataccggcgccgag
aagcgtgaggccgccaagattgccgccaaggacgcgttcgacgtgctcatcgtcggtggt
ggcccggcgggtgctgcggcggcgatctattccgcacgcaagggcattcgcaccggcatc
gtggccgagcgtttcggtggccaggtgatggataccatggggatcgagaacttcatctcg
gtgaaggaaacccaggggccgaagctggttgcggcgctcgaagagcacgtcaagcagtac
gacgtcgacatcatgaacctgcagcgcgcggccaagctggtgccgggcgacatgacggag
gtgcagctcgagaacggtgcctcgctcaaggcgaagaccgtgattcttgcgaccggcgca
cgctggcgcgaaatgaacgtgcccggcgagcaggcgttccgtggcaagggcgtggcctac
tgcccgcactgcgacggcccgctgttcaagggcaagcgtgtggcggtgatcggcggcggc
aactcgggcgtcgaagcggcgatcgacctcgccggcatcgtggcccatgtcaccctgctt
gagtttgccgacaccctgcgtgccgatgcagtgctgcagaagaagctctacagcctgccc
aacgtcaccgtgatcaagagtgcccagaccaccgaagtgaccggtaccgacaaggtcaat
ggcctgatgtacaaggaccgcagcaccgacgaggtgaagcgcatcgagctcgaaggcatc
ttcgtccagatcggcctgctgcccaataccgacttcatgaagggcgcgatcgaactgtcg
cgcttcggcgaagtgatcgtcgacgccaagggccagacctcggtgccgggcatctttgcc
gccggggactgcaccacggtgccttacaagcagatcatcatcgccatgggcgagggttcc
aaggccgcgctgagcgccttcgatcacctgatccggagttcggtcgaagcctga

DBGET integrated database retrieval system