KEGG   Azoarcus communis: CEW83_11275Help
Entry
CEW83_11275       CDS       T05456                                 

Definition
(GenBank) copper ABC transporter ATP-binding protein
  KO
K19340  Cu-processing system ATP-binding protein
Organism
acom  Azoarcus communis
Pathway
acom02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acom00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CEW83_11275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acom02000]
    CEW83_11275
Transporters [BR:acom02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Copper-processing transporter
    CEW83_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: AWI75723
UniProt: A0A2U8GRA8
LinkDB All DBs
Position
2473533..2474474
Genome map
AA seq 313 aa AA seqDB search
MADTSPTPTDSGDAVIVARGVRKHYGAIHAVDGVDLDVRSGELFGLIGHNGAGKSTMFKM
MLGLIPATAGEIRIDGAVVGGGNFRAVRRSVGYLPENVVLYDNLTGLETLQFFARLKAAP
LADCTPALERVGLAHAAKRRVREYSKGMRQRLGFAQALLGKPRILFLDEPTTGLDPEAIR
GFYAILRQLKSEGVTMVITSHILAEIQERVDRLAIMTAGKVQASGTVQALREEMDLPLWF
SVHVASEDFDAVRSALGHLPVIAIEARDDHVAVQCRRESKMAVIEALAGLDGRVRDLTVR
EPSLEDVFFGFSD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacacttcccccaccccgactgattcgggcgacgccgtgatcgtcgcccgcggg
gtccgcaagcactacggcgcaatccacgcggttgacggcgtcgatctcgacgtccgcagc
ggcgagctgtttggcctcatcggccataacggcgccggcaagagcacgatgttcaagatg
atgctcggcctcatccccgcaacggccggcgagatccgcatcgacggcgccgtcgttggc
ggcggcaactttcgcgcagtgcgccgcagcgtcggctacctgccggaaaacgtggtgctc
tacgacaacctgaccggccttgagacgctgcagttcttcgcccgcctgaaggccgcaccg
cttgcagactgcacgcctgcgctggagcgcgtcggcctggcccatgcggcgaagcggcgc
gtccgcgagtactccaagggcatgcgtcagcgcctcggctttgcccaggccttgcttggc
aagccgcgcatcctgtttctggacgaacccacgaccggcctcgaccccgaagccatccgc
ggtttctacgccatcctgcgccagctcaagagcgaaggcgtgaccatggtgatcacctcc
cacatcctcgccgagatccaggagcgggtcgaccggctcgccatcatgaccgcgggcaag
gtccaggccagcggcacggtgcaggcactgcgcgaagagatggatctgccgctgtggttc
agcgttcacgttgcgtccgaagacttcgacgcggtacgcagcgcgctcggccacctgccg
gtgatcgccatcgaggcccgcgacgatcatgtcgccgtgcagtgccggcgcgaatcgaag
atggcggtgatcgaggccctggccggactcgatggccgggtgcgcgacctcaccgtgcgc
gaaccctcgctcgaagacgtgttcttcggcttctcggactaa

DBGET integrated database retrieval system