KEGG   Azoarcus communis: CEW83_12640Help
Entry
CEW83_12640       CDS       T05456                                 

Definition
(GenBank) crotonase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
acom  Azoarcus communis
Pathway
acom00071  Fatty acid degradation
acom00280  Valine, leucine and isoleucine degradation
acom00281  Geraniol degradation
acom00310  Lysine degradation
acom00362  Benzoate degradation
acom00380  Tryptophan metabolism
acom00410  beta-Alanine metabolism
acom00640  Propanoate metabolism
acom00650  Butanoate metabolism
acom00903  Limonene and pinene degradation
acom00930  Caprolactam degradation
acom01100  Metabolic pathways
acom01110  Biosynthesis of secondary metabolites
acom01120  Microbial metabolism in diverse environments
acom01130  Biosynthesis of antibiotics
acom01200  Carbon metabolism
acom01212  Fatty acid metabolism
Module
acom_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CEW83_12640
   00650 Butanoate metabolism
    CEW83_12640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEW83_12640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEW83_12640
   00310 Lysine degradation
    CEW83_12640
   00380 Tryptophan metabolism
    CEW83_12640
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEW83_12640
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CEW83_12640
   00281 Geraniol degradation
    CEW83_12640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CEW83_12640
   00930 Caprolactam degradation
    CEW83_12640
Enzymes [BR:acom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CEW83_12640
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CEW83_12640
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CEW83_12640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Pyr_redox_2 AlaDh_PNT_C EthD UDPG_MGDP_dh_N GIDA
Motif
Other DBs
NCBI-ProteinID: AWI75962
UniProt: A0A2U8GQM4
LinkDB All DBs
Position
complement(2763978..2765987)
Genome map
AA seq 669 aa AA seqDB search
MNQPGNNWQHWTLRREADGLAWLELDKADSTTNALSAAVMEELGSVLDVLDAEPPAALVI
ASAKPAGFIAGADIEEFSQLASAADARVLVARGWTLFERLADVDYPTLALIRGHCLGGGL
ELALACRYRIVVDEPGTKLALPEVMLGIVPGWGGMKRLPDRIGPALALDLMLTGKSVDAK
KAKRIGLADDCVPPRVMENAARMRVRSGSANSPLPWMARLMNGPLRSKVADKARKQVAGR
ARREHYPAPYAIIDMWSRFEGNALAVPAGDPASLETIFASPTTRNLLRVYHLQERLKGFG
KGVDFAPRHVHVIGAGVMGGDIAAVCAQRGLTVTLQDQTVERIAPAIARAAKLFERRFKG
DRRQVRFALDRMIPDPQGHGAVRADVIIEAIFENLEAKRALFSDLERKARPDAILASNTS
SLRLEDIAGCLTDPGRLIGIHFFNPVAMMPLVEVVAGEHSDALALQRAAAFARRIDKLPL
PVKSAPGFLVNAVLGPYMLEALRCVEEGIAPEAVDAALVEFGMPMGPVELVDTVGLDIAV
AAGKALAGDGAAPPQKLLALVSAGKLGKKTGEGYYRWSDGKPKRGKAGTAPAGLADRILA
PLLAATRRCVEEGVVDDADLADAGVIFGTGFAPWSGGPMNYQQTRGNLPVGTDSTVVDRS
APAIQQDAT
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcccggaaacaactggcagcactggacactgcgccgcgaggcggacggcctt
gcctggctcgaactcgacaaggccgacagcacgaccaacgcgctctcggccgcggtgatg
gaagagcttggcagcgtgctggatgtgctcgacgccgagccgcctgccgcactggtgatc
gcgtcggccaaaccggcgggtttcatcgccggcgccgacattgaagaattctcgcaactc
gcctcggccgcagatgcacgtgtactggtcgcacgcgggtggaccctgttcgagcgcctc
gcggacgtcgactacccgacgctggcgttgattcgcggccactgtctgggtggcgggctt
gagcttgcactggcctgtcgttaccggatcgtggtcgacgagccgggtacaaagctcgcg
ctccccgaagtgatgctcggcatcgtgccaggctggggcgggatgaagcgtctgccggac
cgtatcggcccggcactggcgctcgatctgatgctcaccgggaagtctgtcgatgcgaag
aaggcgaagcgtatcggcctcgccgacgattgcgtaccgccgcgggtgatggaaaacgca
gcgcgcatgcgggtgcgttccggcagtgccaattcgcctctgccctggatggcgcgtctg
atgaacgggccgctgaggtcaaaggtggccgacaaggcgcgcaagcaggtggcgggtcgc
gcgcgccgcgaacactatcccgcgccctacgcaatcatcgacatgtggtcgcgcttcgag
ggcaatgcgctggcggtgccggcaggtgatccggcttcgctggagacgattttcgcctcg
ccgaccacgcgcaacctcctgcgggtgtatcacctgcaggagcgcctcaagggttttggc
aagggtgtcgattttgcgccgcggcatgtgcatgtgatcggtgccggcgtgatgggcggc
gacatcgccgccgtgtgcgcacagcgcggcctgacggtgaccctgcaggaccagaccgtt
gagcgcatcgcgcctgcaattgcgcgggcggcaaagctgttcgagcgccgcttcaagggc
gaccgccgccaggtgcgttttgcgctcgaccgcatgattcccgaccctcagggccacggc
gcggtgcgggccgatgtcatcatcgaggccatcttcgagaaccttgaggcgaagcgtgca
ctgttctcagatcttgagcgcaaggcgcggccggatgcgattctggccagcaatacctcc
agtctgaggctggaagacatcgccggctgcctgaccgatcccggtcgtctcattggcatt
catttcttcaacccggtggcgatgatgccgctggtcgaggtggtggcgggtgagcactcg
gatgcgcttgccttgcagcgcgcggcggcctttgcgcgcaggatcgacaagctgccgctg
ccggtgaaaagcgcgcccggcttcctcgtcaatgcggtgctcgggccctacatgctcgag
gccttgcgttgtgtcgaagagggcattgcgcccgaggccgtagacgccgcgctggtcgag
ttcggcatgccgatggggccggtcgagttggtggatacggtcggcctcgacattgctgtc
gcggcaggcaaggcacttgccggcgatggtgcagcgccgccgcaaaagctcctcgcgctg
gtgtccgccggcaagctcgggaagaagaccggggaaggctactaccgctggagcgatggc
aagccgaagcgcggcaaggccggtactgcgccagcaggcctcgccgatcgcattcttgcg
ccgctgcttgccgctacccggcgctgcgtggaagagggggtggtcgatgatgccgacctg
gcagacgctggcgtgatcttcggcaccggctttgcaccctggagcggcggcccgatgaat
taccagcagacccgcgggaatctcccggtcggcaccgattccaccgtcgtcgatcgtagt
gcaccggctattcaacaggacgcgacatga

DBGET integrated database retrieval system