KEGG   Azoarcus communis: CEW83_15660Help
Entry
CEW83_15660       CDS       T05456                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
acom  Azoarcus communis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-ProteinID: AWI76470
UniProt: A0A2U8H0R9
LinkDB All DBs
Position
complement(3436873..3437820)
Genome map
AA seq 315 aa AA seqDB search
MPPQANCALPSGFQLDHYKIERQLSLGGFSIVYLAYDTDGTPVAIKEYLPNSLALRKDGE
IEPQVSDENQPAFRYGMKCFFEEGRSLAKLMHPNVVRVLNFFRANQTVYMVMQFERGRTL
HDYIQKHKGEVRERFIRGVFTRMLNGLREVHAHKLLHLDIKPSNIYLRADSTPVLLDFGA
ARQTLALEQPMLKPMYTPGFASPEQFGNREALGPWSDIYSVGASMYACIVGTAPLRSDER
IKRDTVQPVSKTHAGKYSEQLLELVEWCLHLDPLKRPQSVYSLQKALMQKQAGEAMPATW
FTDLGSRLKTFIGKG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctcaagcaaactgcgcactcccctccggctttcaactcgatcattacaagatc
gagcgccagctatcgctcggcggcttctccattgtgtatctcgcttacgataccgacggc
acgccggtcgcgatcaaggagtacctgccgaactcgctcgccctgcgcaaggacggcgag
atcgaaccgcaggtctcggacgaaaaccagcccgccttccgctacggcatgaagtgcttt
ttcgaggaagggcgctcgctggccaagctgatgcatcccaacgttgtgcgcgtgctcaac
ttcttccgcgccaaccagacggtgtacatggtgatgcagttcgagcgcggccggaccctc
cacgactacatccagaagcacaagggcgaggtgcgcgagcgcttcatccgcggcgtgttc
acccgcatgctcaacggcctgcgcgaagtgcatgcgcacaagctgctgcacctcgacatc
aagccatcgaacatctacctgcgtgcagacagcacgccggtgctgctcgacttcggcgcc
gcacgccagacgctggcgctcgagcagccgatgctcaagccgatgtacacccccggcttc
gcctcgcccgagcagttcggcaaccgcgaagcccttggcccctggagcgacatctacagt
gtcggcgccagcatgtatgcctgcatcgtcggcactgccccgctgcgttctgacgagcgc
atcaagcgcgataccgtacaaccggtatcaaaaacgcatgccggcaagtattctgaacag
ctattggaactggtcgagtggtgcctgcacctcgaccccctgaaacgtccgcaaagcgtc
tattcgttgcagaaggcgctgatgcaaaagcaggcgggcgaagccatgccggcgacctgg
ttcaccgacctcgggtcccggctcaaaaccttcatcggcaagggctga

DBGET integrated database retrieval system