KEGG   Azoarcus communis: CEW83_19375Help
Entry
CEW83_19375       CDS       T05456                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acom  Azoarcus communis
Brite
KEGG Orthology (KO) [BR:acom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acom01001]
    CEW83_19375
Enzymes [BR:acom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CEW83_19375
Protein kinases [BR:acom01001]
 Serine/threonine kinases: Other
  Bacterial family
   CEW83_19375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding APH Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AWI77126
UniProt: A0A2U8GVR9
LinkDB All DBs
Position
complement(4251534..4252820)
Genome map
AA seq 428 aa AA seqDB search
MQVERIGKYEIRSLLGEGATSAVYLAWDAFHQREVALKQLYPELVSDRDRGRLYRQLMLN
EAALAGKLTHPHIAQIYDAVIDDNDAYVVMEFVPGGTLEALVRPDSLPPFERLIEIIFKC
SRALDYAFHQGVTHRDIKPANILLCKPDGSDIRISDFGAALQKASETTQIAGIGSPAYMS
PQQVREMPLDHRTDIYSLGVVMYQMLTGRLPFEADNNYSLIYRIANDTPQPPIELRPEIP
EALDAIVRRAMEKELDRRYQTWAEFSHDLALAFRNRSIALDRKTLPEAEKFQTLRSIAFF
REFADAELWEIITLTQWSHLQPGTMIMKEGEAGDHFCFLAEGEARVKKRGKLLNVLSAGE
CFGEMALFSAGGGIRSASIEAATEVEVITMRARALQRASDTCRMHFYKAFLEVLSTRLSL
MSARIANL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtggagcggatcggaaagtacgagattcgcagccttcttggcgaaggggcgacc
agtgccgtctatctggcatgggacgccttccaccagcgtgaagtcgcactcaagcagctg
tatccggagctcgtcagcgaccgcgaccgcggccgcctctatcgtcagctcatgctcaac
gaggcggccctcgccggcaaactcacccacccgcacatcgcccagatctacgatgcagtc
atcgacgataacgacgcctatgtggtgatggagttcgtgccgggcggaacgctcgaggcg
ctggtgcgccccgacagcctgccgccattcgagcgcctgatcgagatcatcttcaagtgc
agccgggcgctcgattacgccttccaccagggcgtcacccatcgcgacatcaagcccgcc
aacatcctgctgtgcaagcccgacggcagcgacatccgcatctcggacttcggcgcggcc
ctgcaaaaggcaagcgagaccacccagatcgcgggcatcggctcgccggcctacatgtcg
ccgcagcaggtgcgcgagatgccgctggatcatcgcaccgacatctattcgctcggcgtg
gtgatgtaccagatgctgaccggccgcctgcctttcgaggccgacaacaactacagcctg
atctaccgcatcgccaacgacaccccacagcctccgatcgaactgcgacccgagatcccc
gaggcactcgacgccatcgtgcgtcgcgcgatggaaaaggaactcgaccgccgctaccag
acctgggccgagttctcgcacgatctggcactggcgtttcgcaaccgcagtatcgcgctg
gaccggaagacgctccccgaagccgaaaaattccagaccttgcgcagcattgccttcttt
cgcgagttcgccgatgcggaactgtgggagatcatcacgctgacgcaatggagccacctg
caacccggcaccatgatcatgaaggaaggtgaagcgggcgatcacttctgctttcttgcc
gaaggcgaagcacgagtcaagaaacggggcaaattgctgaatgtactcagcgccggcgag
tgcttcggcgagatggcactgttctcggctggcggcggcatccgctcggcgtcaatcgaa
gccgccaccgaggtcgaagtcatcaccatgcgcgcgcgcgcactgcagcgcgcatccgac
acctgccgcatgcatttctacaaggcatttctggaagtgctgtctacacggctgtcgctg
atgagtgcgaggattgcgaacctttga

DBGET integrated database retrieval system