KEGG   Azoarcus communis: CEW83_20560Help
Entry
CEW83_20560       CDS       T05456                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acom  Azoarcus communis
Pathway
acom00630  Glyoxylate and dicarboxylate metabolism
acom00710  Carbon fixation in photosynthetic organisms
acom01100  Metabolic pathways
acom01120  Microbial metabolism in diverse environments
acom01200  Carbon metabolism
Module
acom_M00165  Reductive pentose phosphate cycle (Calvin cycle)
acom_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CEW83_20560
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CEW83_20560
Enzymes [BR:acom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CEW83_20560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AWI77331
UniProt: A0A2U8GUS4
LinkDB All DBs
Position
complement(4499786..4500211)
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSFLPDLSDSQIGAQIHYCLNQGWAVALEYTDDPHPRNTYWSMWGLPMFDLAD
PAGVMQELQACREANPGHYIRVNAFDSTKGWETVRMSFIVQRPPSEPGFRLVRQETGGRN
LRYTLESYAVGAGTEGARYAG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcactcagggctgcttttcattcctgcccgatctgagcgacagccagatcggg
gcacagatccactactgcctgaatcagggttgggcggtcgcgctcgaatatacggacgat
ccgcatccacgcaacacctactggtcgatgtggggtctgccaatgttcgacctggccgac
ccggccggcgtcatgcaggagctgcaggcctgccgcgaggccaatcccggccactacatc
cgggtaaacgcattcgattcgaccaagggctgggagacagtgcgcatgtccttcatcgtc
cagcgccctcccagcgaacccggcttccgtctggtacgccaggagaccggaggacgaaac
ctgcgctacacgctcgagagctatgccgtgggcgcaggcacagagggcgcccgatacgcc
ggctga

DBGET integrated database retrieval system