KEGG   Azoarcus communis: CEW83_20560Help
Entry
CEW83_20560       CDS       T05456                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acom  Azoarcus communis
Pathway
acom00630  Glyoxylate and dicarboxylate metabolism
acom00710  Carbon fixation in photosynthetic organisms
acom01100  Metabolic pathways
acom01110  Biosynthesis of secondary metabolites
acom01120  Microbial metabolism in diverse environments
acom01130  Biosynthesis of antibiotics
acom01200  Carbon metabolism
Module
acom_M00165  Reductive pentose phosphate cycle (Calvin cycle)
acom_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CEW83_20560
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CEW83_20560
Enzymes [BR:acom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CEW83_20560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AWI77331
UniProt: A0A2U8GUS4
LinkDB All DBs
Position
complement(4499786..4500211)
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSFLPDLSDSQIGAQIHYCLNQGWAVALEYTDDPHPRNTYWSMWGLPMFDLAD
PAGVMQELQACREANPGHYIRVNAFDSTKGWETVRMSFIVQRPPSEPGFRLVRQETGGRN
LRYTLESYAVGAGTEGARYAG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcactcagggctgcttttcattcctgcccgatctgagcgacagccagatcggg
gcacagatccactactgcctgaatcagggttgggcggtcgcgctcgaatatacggacgat
ccgcatccacgcaacacctactggtcgatgtggggtctgccaatgttcgacctggccgac
ccggccggcgtcatgcaggagctgcaggcctgccgcgaggccaatcccggccactacatc
cgggtaaacgcattcgattcgaccaagggctgggagacagtgcgcatgtccttcatcgtc
cagcgccctcccagcgaacccggcttccgtctggtacgccaggagaccggaggacgaaac
ctgcgctacacgctcgagagctatgccgtgggcgcaggcacagagggcgcccgatacgcc
ggctga

DBGET integrated database retrieval system