KEGG   Azoarcus communis: CEW83_20835Help
Entry
CEW83_20835       CDS       T05456                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acom  Azoarcus communis
Brite
KEGG Orthology (KO) [BR:acom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acom01001]
    CEW83_20835
Enzymes [BR:acom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CEW83_20835
Protein kinases [BR:acom01001]
 Serine/threonine kinases: Other
  Bacterial family
   CEW83_20835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding APH Cupin_2 Kinase-like Pkinase_fungal Haspin_kinase RIO1 Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: AWI77380
UniProt: A0A2U8GVD1
LinkDB All DBs
Position
4553261..4554625
Genome map
AA seq 454 aa AA seqDB search
MGTMPERVGKYRIVRELGRGATAVVYLAENPHYPEQIALKHVKFDDKARDVAKWNRRLLK
LLKAEGAVSKRLDHPNIIRIFEAVVEADQAYVVMEYFPGYTLERYCSFEKLLPIHRVIGI
IFKCCMALDHAYRQGIVHRDIKPANILIDDNDNVKITDFGLALNISKKIETDSTFIMGVG
SPAYMSPEQIKSYPLNQKTDLYSLGVVLFHLLTGRLPFRAANPAQLIYKIINADQPSVSQ
LNPEIPEQMDAVIRKALEKDLYSRYKNGAEFAKDLAAVRYKIVDDKCVPPDTSRFTMLRK
LAFFTEFDDIELWEVLRICSWRKVDEHVTLMREGDADQRFAIVLSGQVEVSIDGRRVLTL
GPGEVFGEQAWLDHLEHRHMMTSVSLEPLTYLEINPPALALATDEVQELFRRQVSTVVVR
RLADIARVAAQDGEPAVRGDYTATGGLDLQLVED
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaatgcccgaaagagtcgggaagtaccgaatcgttcgcgagctgggtcgcggt
gcgacggctgttgtctacctcgccgagaatccgcattaccccgagcagatcgcgctcaag
cacgtcaagtttgacgacaaggcgcgagacgtcgcgaagtggaaccgccgtctgctgaag
ctgctgaaagccgagggtgcggtgtccaagcgcctggaccaccctaacatcattcgcatt
ttcgaggcggtggtcgaggcggaccaagcctacgtggtgatggagtacttccccggctac
acccttgagcgctactgcagtttcgaaaagctgctcccgatccaccgcgtgatcggcatc
atcttcaagtgctgcatggcgctcgatcatgcctatcggcagggaatcgtccatcgtgac
atcaagcccgccaacatcctgatcgacgacaacgacaacgtgaagatcaccgacttcggg
ctggcgctgaacatcagcaagaagatcgagaccgactccaccttcatcatgggcgtaggg
tcgccggcctacatgagtccggagcagatcaagagctatccgctcaaccagaagaccgat
ctctattcgctcggcgtggtgctgttccatctgctcaccggccgcctgccgttccgcgca
gccaacccggcgcagctgatctacaagatcatcaacgcagaccagccctcggtttctcag
ctcaatcccgagattcccgagcagatggatgcggtcatccgcaaggcgctcgagaaagac
ctctactcccgctacaagaacggtgccgagtttgccaaggatctcgccgcagttcgctac
aagatcgtcgacgacaagtgcgtgccgcccgatacgagccggttcacgatgttgcgcaag
ctggccttcttcaccgagttcgatgatatcgagttgtgggaggtcttgcgcatctgctca
tggcgcaaggtcgacgagcatgtgacgctgatgcgagagggcgacgccgaccagcgtttc
gccatcgtgctgtcgggtcaggtcgaggtgtcgattgacgggcgcagggtgctgacgctc
gggccgggcgaggttttcggcgagcaggcctggctcgatcatcttgagcatcgtcacatg
atgacctcggtctcgctcgagccgctgacttatctcgaaatcaatccgcccgcgctggcg
ctggcgacagacgaggtgcaggagttgttcaggcgccaggtgtcgaccgttgtggtcagg
cgcctcgcggatatcgcccgggtcgcggcgcaggacggcgagcccgcggtccgtggtgac
tacaccgccaccggcgggctcgatctgcaactggtcgaggactga

DBGET integrated database retrieval system