KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0133Help
Entry
A2cp1_0133        CDS       T00833                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Brite
KEGG Orthology (KO) [BR:acp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acp01001]
    A2cp1_0133
Enzymes [BR:acp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A2cp1_0133
Protein kinases [BR:acp01001]
 Serine/threonine kinases: Other
  Bacterial family
   A2cp1_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo DZR
Motif
Other DBs
NCBI-ProteinID: ACL63492
UniProt: B8J800
LinkDB All DBs
Position
151847..153619
Genome map
AA seq 590 aa AA seqDB search
MPGPLAIPDLRAPCPGCGHLAEPTGGPLNFCPRCGLDLRETARRAPPADPLVGRVIADRY
RLVSLLGEGGMGAVYRAEHVQMGKALAVKVLRGDFARDPSAAERFRAEARIVSRLSHPHT
IAVFDFGELPERGFYLAMEYVPGQDLARALREGGALSEARAVGIAQQVLGSLAEAHESGV
VHRDMKPANVMLMQARPGEDFAKVLDFGIAKLRDEAGGATTGAGAVVGTPSCLAPEQARG
GPVDARADLYAMGCLLYELVSGRPPFTAASPVAVITAHLHDAPPPLREVAPGVSRRLAEV
VHRALRKDPAERFPSADAMRDALAGPGHAARPSRRPALPRAAGELELASREDFRDGLEQG
ALERQVGVLRPPRLVTPARAALAIAAALAAGAAWRWDDLYAALAAAAPAIATQVPAALRP
DAAAWVEREPNDGAAEATPLPLLPRADGVPAAEVRGAIGAPRRPDEGDLDVYRLVVPDGA
GGRVLRARWHAAGAAPDQGIPGLAVTLSLNRAPAGAERAPLVAAAGEGGPGAAEALSAEV
EPGTYWLSVRERHAAGAAPAARPEAPYALEVELAPRAASEAAGEGDGPHK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccccctggcgatccccgacctccgcgccccgtgccccggctgcggacacctc
gcggagccgaccggcgggccgctgaacttctgcccgcgctgcggcctcgacctgcgggag
acggcgcgccgcgcgccgccggcggacccgctggtgggccgggtgatcgcggaccgctac
cggctcgtctccctgctcggcgagggcgggatgggcgcggtctaccgggccgagcacgtg
cagatgggcaaggcgctcgcggtgaaggtgctgcgcggcgacttcgcccgcgacccgtcc
gccgcggagcgcttccgcgccgaggcgcgcatcgtgtcgcgcctctcgcacccgcacacc
atcgcggtcttcgacttcggcgagctgcccgagcgcggcttctacctcgccatggagtac
gtgcccgggcaggacctggcgcgggcgctgcgcgagggcggcgcgctctccgaggcgcgg
gcggtcggcatcgcccagcaggtgctcggatcgctggccgaggcgcacgagtcgggcgtg
gtccaccgcgacatgaagcccgcgaacgtgatgctgatgcaggcgcggccgggcgaggac
ttcgcgaaggtgctcgacttcgggatcgcgaagctgcgcgacgaggcgggcggcgccacc
accggggcgggcgcggtggtgggcacgccgagctgcctcgcgccggagcaggcccgcggc
ggcccggtggacgcgcgcgccgacctctacgccatgggctgcctgctgtacgagctcgtg
tccgggcggccgccgttcaccgcggcgagcccggtggcggtgatcaccgcgcacctccac
gacgcgccgccgccgctccgggaggtcgccccgggcgtctcgcgccggctcgccgaggtg
gtccaccgcgcgctccgcaaggatcccgccgagcggttcccgagcgcggacgcgatgcgc
gacgcgctcgcggggcccgggcacgcagcccggccgtcccgccgccccgcgctcccccgg
gccgcgggcgagctggagctggcgagccgggaggacttccgcgacggcctggagcagggc
gccctggagcggcaggtgggcgtgctgcggccgccgcggctcgtcaccccggcccgcgcc
gcgctggccatcgccgccgcgctcgccgccggcgcggcctggcgctgggacgacctgtac
gcggcgctcgcggccgccgcgcccgcgatcgcgacgcaggtgccggcggcgctccgcccg
gacgcggccgcctgggtggagcgcgagccgaacgacggcgcggcggaggcgacgccgctc
ccgctgctcccgcgggcggacggcgtgcccgccgcggaggtccgcggcgccatcggcgcg
ccgcgccggccggacgagggcgacctcgacgtctaccggctggtggtgccggacggcgcg
ggcggccgcgtgctgcgggcgcgctggcacgcggcgggggccgcgccggaccagggcatc
ccggggctcgcggtgacgctctcgctcaaccgggcgccggccggcgccgagcgcgcgccg
ctggtggccgcggcgggcgagggcggcccgggcgcggccgaggcgctctcggccgaggtc
gagccgggcacctactggctgtcggtgcgcgagcggcacgcggcgggcgccgcgccggcg
gcgcgcccggaggcgccgtacgcgctcgaggtggagctcgcgccgcgcgcggcgagcgag
gccgcgggcgagggcgacggaccccacaaatga

DBGET integrated database retrieval system