KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0836Help
Entry
A2cp1_0836        CDS       T00833                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A2cp1_0836
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acp03400]
    A2cp1_0836
Enzymes [BR:acp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A2cp1_0836
DNA repair and recombination proteins [BR:acp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A2cp1_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ACL64188
UniProt: B8JDU3
LinkDB All DBs
Position
complement(936643..938694)
Genome map
AA seq 683 aa AA seqDB search
MPACPAGARRGRRLPRHAGGGELSRVARAPVPIYRAQLATLVATPPAGDGWVHETKYDGY
RIGCSLEGGRATLWSRRGNDWTAQFPEVAQAAEALAARSALLDGEVAAVLPGGRTSFQAL
QQAFSGGRRSLAYFVFDLLWLDGEDLSGRPLLERKDALRRLLGARGAVLRYAPHVEAPGA
EVLREACRLGLEGIVSKRADAPYRPGRNTTWTKAKCLARQELVIGGFTDPEGSRQGIGAL
LVGFHEGGALRFAGKVGTGFTQASARALRARLDRLGRADPPFTPRPPGALGRIAHWVRPE
LVAEVAFTEWTDDGKVRHPSFQGLREDKRAADVVREVPGGAPPAPPVPPAPAPAPAAAGR
ARRRAAAGAAGEVVIGGVRLSHPERTVFPGDGRAALTKADVARYYDAVAGAMVPHLRGRP
LTLFHCPEGIAGECRFMKHSKTWAPPAVRRVRIQEKTKLGEYLIADDRAALLALVQMDVL
ELHTWNSTVEALEQPDRIVLDLDPGPEVPWREVVRAARLLRSALEALGLAAFVKTTGGAG
LHVVTPLVPRRRWEDCLAFARGLAATVARHEPRAFTVALARAGRERKILLDYLRNNRTNT
SVAAFSLRARPGAPASVPVAWDELGPRLRPERLDARTVPRRLARLGADPWAGWARAARPL
GDAHLAAVGAAPVDQPARGGGRR
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctgccccgccggcgcccgccgggggcgccgcttgccccgccacgccgggggt
ggtgagctttcccgcgtggcccgcgcgcccgtcccgatctaccgcgcccagctcgcgacg
ctcgtcgcgaccccgccggcgggggacggctgggtccacgagacgaagtacgacggctac
cggatcggctgttcgctggagggcgggcgcgccacgctgtggagccggcggggcaacgac
tggaccgcgcagttccccgaggtggcgcaggccgccgaggcgctggcggcgcggagcgcg
ctcctcgacggcgaggtggcggcggtgctgcccggcggccggaccagcttccaggcgctc
cagcaggcgttctccgggggccgccgctcgctcgcctacttcgtgttcgacctgctctgg
ctggacggcgaggacctgtccgggcggccgctgctcgagcgcaaggacgcgctgcgccgg
ctcctcggcgcgcgcggcgccgtgctccggtacgcgccgcacgtggaggcgccgggcgcc
gaggtgctccgcgaggcgtgccgcctcggcctggaggggatcgtctcgaagcgcgccgac
gcgccgtaccgccccgggcggaacaccacctggacgaaggcgaagtgcctcgcccgccag
gagctggtgatcggcgggttcaccgatcccgagggcagccgccagggcatcggggcgctg
ctggtgggcttccacgagggcggcgcgctgcgcttcgccgggaaggtcggcaccggcttc
acgcaggcgtcggcgcgggcgctgcgcgcgcgcctcgatcgcctgggccgcgccgacccg
ccgttcacgccccggccgccgggcgcgctcgggcggatcgcgcactgggtgcggccggag
ctggtggccgaggtggcgttcaccgagtggaccgacgacgggaaggtgcggcatccgtcg
ttccaggggctgcgcgaggacaagcgcgccgcggacgtggtgcgcgaggtccccggcggc
gcgccaccggccccgccggtcccaccggcgcctgcgcctgcgccggcggccgcgggtcgc
gccaggcgccgcgcggcggcgggcgcagccggcgaggtggtgatcggcggcgtccggctc
tcgcacccggagcgcaccgtgttcccgggcgacgggcgggccgcgctcaccaaggccgac
gtggcccggtactacgacgcggtggccggcgcgatggtgccgcacctgcgcggccgcccg
ctgaccctgttccactgcccggagggcatcgccggcgagtgccgcttcatgaagcactcg
aagacctgggcgccgcccgccgtgcggcgggtgcgcatccaggagaagaccaagctgggc
gagtacctgatcgccgacgaccgcgccgcgctgctcgcgctggtgcagatggacgtcctc
gagctgcacacctggaactcgaccgtggaggcgctggagcagccggaccggatcgtgctc
gacctcgacccggggccggaggtcccgtggcgcgaggtggtgcgcgcggcgcggctgctg
cgctcggcgctggaggcgctgggcctcgccgcgttcgtgaagaccaccggcggcgcgggg
ctgcacgtggtgacgccgctggtgccgcgccggcgctgggaggactgcctcgcgttcgcg
cgcgggctcgccgccacggtggcgcgccacgagccgcgcgcgttcaccgtggcgctcgcg
cgcgccgggcgcgagcggaagatcctcctcgactacctgcggaacaaccggaccaacacc
tcggtggccgcgttctcgctgcgcgcgcggccgggcgcgccggcctcggtgccggtggcc
tgggacgagctgggcccgcggctgcggccggagcggctggacgcgcgcaccgtcccgcgg
cggctggcgcggctcggcgcggatccgtgggccggctgggcgcgcgccgcccggccgctc
ggcgacgcgcacctcgccgcggtgggcgccgcgccggtggaccagccggcgcggggcggg
gggcggcggtga

DBGET integrated database retrieval system