KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1212Help
Entry
A2cp1_1212        CDS       T00833                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00061  Fatty acid biosynthesis
acp00780  Biotin metabolism
acp01100  Metabolic pathways
acp01212  Fatty acid metabolism
Module
acp_M00083  Fatty acid biosynthesis, elongation
acp_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A2cp1_1212
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A2cp1_1212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acp01004]
    A2cp1_1212
Enzymes [BR:acp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A2cp1_1212
Lipid biosynthesis proteins [BR:acp01004]
 Fatty acid synthase
  Component type
   A2cp1_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: ACL64556
UniProt: B8JFW8
LinkDB All DBs
Position
1362464..1362934
Genome map
AA seq 156 aa AA seqDB search
MSESAERKSILDVVGIQKLLPHRPPFLLVDRVVEFEAHRRLVALKGVTMNEPFFQGHFPA
QPVMPGVLILEALAQAAALLATMSLQPDEVKDKITYLMGIDGARFRRPVVPGDRLELEVE
VTKQKGAVWKQTGVARVDGQVVAEAEFMAMLADRER
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagcgcggagcgcaagtcgatcctcgacgtggtcgggatccagaagctgctg
ccgcaccggccgccgttcctgctggtggaccgggtggtggagttcgaggcgcaccggcgg
ctggtggcgctgaagggcgtcaccatgaacgagccgttcttccaggggcacttcccggcc
cagccggtgatgcccggggtgctcatcctggaggcgctcgcccaggcggccgcgctgctc
gccacgatgtccctgcagcccgacgaggtgaaggacaagatcacctacctcatgggcatc
gacggggcgcgcttccgccgcccggtggtgccgggcgaccggctcgagctcgaggtcgag
gtgacgaagcagaagggcgccgtctggaagcagaccggcgtcgcgcgcgtcgacggccag
gtggtcgccgaggccgagttcatggcgatgctcgccgaccgcgagcggtag

DBGET integrated database retrieval system