KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1454Help
Entry
A2cp1_1454        CDS       T00833                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00550  Peptidoglycan biosynthesis
acp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A2cp1_1454
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A2cp1_1454
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acp01011]
    A2cp1_1454
Enzymes [BR:acp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A2cp1_1454
Peptidoglycan biosynthesis and degradation proteins [BR:acp01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A2cp1_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACL64798
UniProt: B8JH96
LinkDB All DBs
Position
1627447..1629501
Genome map
AA seq 684 aa AA seqDB search
MSLIPPSAPGAAQKEFRPRLAWATGLVVLVFLTLLGRLYQLQILRGDEYKERADENFVKE
LRIPADRGLMLDRNRRVLVDSRPSYDVTLTPYFCGKQCDEILARVAALLQMSPEEVARAQ
GQLRSARKLERFRPFTVKVDITREELDRYLARQMDLPGVDVQPIPHRNYRFGGLGGHLIG
YMNEVGGEELKRLNEELQRTASPQGPYYMGDYVGRRGLERRFERDLRGVDGKERVPVDAK
GRRKEDADDLIPPDQRVVPSVPGRNLVLSIDWRLQEFAEQTFPATAGVVLAMDAKTGFLL
ALVDRPAPDPNKMSGRITAAELAAIHSDPLQPELFRAIQQHYHPGSTFKALTSIAALEEG
VYKPNTSVYCPGHFSMGRARWRCDKDSGHGYVDFEHALGASCDVFFYAAGAQLGADAIAK
WGHLSGLGVPTGFDIAGEVPGVVPDAAWHDKHQAGGYQRGMAVNLSIGQGDVNVTPMQQL
VFYGALATGKIWKPQVVLRVEDPDGQVLQAFTPETRGELPVKPSTRDTVLKGLLAAVNQP
FGTAYSQRSADYVMAGKTGTAQVVKLGARRLKASQVSYFERDHAWFAAFAPAEDPEIVVV
VLNEHSGFGSSNAAPTASALVKRYFQLKAEDAAERAGPAQGPAPERAPAPPAAPPAAPPP
GAVEPARLGTGGASAAVPGVDRGA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatcccgcccagcgcgcccggtgcggcgcagaaggagttcaggccgcggctg
gcctgggccacgggcctggtggtgctcgtgttcctgacgctgctcgggcgtctgtaccag
ctccagatcctccgcggcgacgagtacaaggagcgcgccgacgagaacttcgtgaaggag
ctgcgcatccccgccgaccgcggcctgatgctcgaccgcaaccggcgcgtgctggtggac
tcgcggccctcgtacgacgtgacgctcacgccgtacttctgcgggaagcagtgcgacgag
atcctggcgcgcgtggcggcgctgctgcagatgtcgcccgaggaggtggcccgcgcgcag
gggcagctccgctcggcgcgcaagctcgagcgcttccgcccgttcaccgtgaaggtggac
atcacgcgcgaggagctggaccggtacctggcgcgccagatggacctgcccggcgtggac
gtccagcccatcccgcaccgcaactaccgcttcggcgggctgggcgggcacctcatcggc
tacatgaacgaggtcgggggcgaggagctgaagcgcctcaacgaggagctgcagcgcacc
gcctcgccgcagggcccctactacatgggcgactacgtcggccgccgcggcctggagcgc
cgcttcgagcgcgacctgcgcggcgtggacggcaaggagcgcgtgccggtggacgcgaag
gggcgccgcaaggaggacgcggacgacctcatcccgcccgaccagcgcgtggtcccgagc
gtgcccgggcgcaacctggtgctgtccatcgactggcgcctgcaggagttcgccgagcag
acgttccccgccaccgccggcgtggtgctggcgatggacgcgaagaccggcttcctgctc
gcgctggtggaccgccccgcgccggatccgaacaagatgtccggacgcatcaccgcggcc
gagctggcggcgatccactcggacccgctgcagcccgagctgttccgcgccatccagcag
cactaccaccccggctccaccttcaaggcgctcaccagcatcgcggcgctggaggagggg
gtctacaagccgaacacctcggtgtactgcccggggcacttcagcatgggccgcgcgcgc
tggcgctgcgacaaggacagcggccacggctacgtggacttcgagcacgcgctgggcgcg
agctgcgacgtgttcttctacgcggccggcgcgcagctcggcgccgacgccatcgcgaag
tggggccacctctccggcctgggcgtgcccaccgggttcgacatcgccggcgaggtgccg
ggcgtggtgcccgacgcggcctggcacgacaagcaccaggccggcggctaccagcgcggc
atggcggtgaacctgtccatcggccagggcgacgtgaacgtcacgcccatgcagcagctc
gtgttctacggcgcgctcgccaccggcaagatctggaagccgcaggtggtgctgcgcgtg
gaggacccggacggccaggtgctgcaggcgttcacgccggagacgcgcggcgagctgccg
gtcaagccgtccacccgcgacaccgtgctgaaggggctgctcgcggcggtgaaccagccg
ttcggcaccgcctactcgcagcgctccgccgactacgtcatggcgggcaagaccgggacg
gcgcaggtggtgaagctgggcgcgcggcgcctcaaggcgtcgcaggtgtcgtacttcgag
cgcgaccacgcgtggttcgcggcgttcgcgccggcggaggatccggagatcgtggtggtg
gtcctgaacgagcactcgggcttcggctcgtcgaacgcggcgccgaccgcgtcggcgctg
gtgaagcggtacttccagctgaaggcggaggacgcggccgagcgggccggcccggcgcag
ggcccggcgcccgagcgcgccccggcgcctcccgccgcgccgcccgcggcgccgccgccc
ggcgcggtcgagccggccaggctgggcacgggcggcgcgtccgccgcggtgccgggggtg
gaccgtggcgcctga

DBGET integrated database retrieval system