KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2012Help
Entry
A2cp1_2012        CDS       T00833                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Brite
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A2cp1_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N CsiD
Motif
Other DBs
NCBI-ProteinID: ACL65353
UniProt: B8J854
LinkDB All DBs
Position
2266033..2266638
Genome map
AA seq 201 aa AA seqDB search
MADVKRYTPHDFSKVRGLTGISDKQIEEHLKLYEGYVKRTNALTEKLQGLCNEGKAAGAD
PVFAELTRRLGFEYSGMVNHEYYFANLAPGAQAEPPAGGKLRKAIEASFGKYETWLADFR
AIATMPGIGWAMTFQDPNTGWLSNHWLTLHENNVPVGFRPVLALDGWEHAFMRDYLATER
AKYVDAFFKNVNWEAVEKRIA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtgaagcgctacaccccgcacgacttctccaaggtccgcggcctcaccggc
atctcggacaagcagatcgaggagcacctcaagctgtacgagggctacgtgaagcgcacc
aacgcgctcaccgagaagctccaggggctgtgcaacgaggggaaggccgcgggcgccgat
ccggtgttcgcggagctcacccgccgcctcggcttcgagtactccggcatggtgaaccac
gagtactacttcgcgaacctcgccccgggcgcgcaggccgagccgccggccggcggcaag
ctccgcaaggccatcgaggcgtcgttcggcaagtacgagacgtggctcgccgacttccgc
gccatcgccaccatgccgggcatcggctgggccatgacgttccaggatccgaacaccggc
tggctctccaaccactggctcacgctgcacgagaacaacgtgccggtgggcttccggccg
gtgctggcgctggatggctgggagcacgcgttcatgcgcgactacctcgccaccgagcgc
gcgaagtacgtggacgcgttcttcaagaacgtgaactgggaggccgtcgagaagcggatc
gcgtag

DBGET integrated database retrieval system