KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2639Help
Entry
A2cp1_2639        CDS       T00833                                 

Definition
(GenBank) metal dependent phosphohydrolase
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD tRNA_anti-codon TraI_2 HD_6
Motif
Other DBs
NCBI-ProteinID: ACL65976
UniProt: B8JDC7
LinkDB All DBs
Position
2911493..2913079
Genome map
AA seq 528 aa AA seqDB search
MDKIWAKDVKEGERAKSVFLVARKAIPTAKSGKTYLSVTFQDKTGELEARAFEKVEELAA
AFEEKDLVEVEGAIGAFQGKPQLRIEALAKVDPTTLDAAEFVWAPPPEPKKPEKSGPAEA
ESGHWNELLALVDCVVDPHVKDLIKAFVEDDDVAARLRRAPAAKTVHHAYPGGLLEHTVS
CLKLAHRLADHFPQVDRDLLVAGAFFHDLGKIRELSGDRSTEYTDEGRLIGHLVMTAQWI
HDKARRVGASRDLEHHVVHMVLSHHGRLEYGSPKVPMTLEAMLTHAIDEIDSRVNSWLNL
MGKDGGNRRWTDANNVYEQPIWRGSLPTVQAEKKGPAPELLTPVIYVPRNGASAGGGAQP
RPPKKPRDRKREPRPQGGAAEAKPAEGAGEAKAEGAPAAAQAPRPEGRPERPDRGQREHR
GFGGGGGGFGDKKRGYTGPRLPGDKGPHRPPEKKNLTHNPFAALAQKLEDAGKPAEEKPA
SPAEAEQQQAPAPTPPEPQDQAVAAREPDVAPEPAPAGTPAPEDKPAG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatctgggccaaggacgtcaaggagggagagcgcgccaagagcgtgttcctc
gtcgcccgcaaggcgatccccaccgcgaagagcggcaagacgtacctctccgtcaccttc
caggacaagaccggcgagctcgaggcgcgcgccttcgagaaggtcgaggagctggcggcg
gccttcgaggagaaggatctcgtcgaggtggagggcgccatcggcgcgttccagggcaag
ccgcagctgcgcatcgaggcgctcgccaaggtcgacccgaccacgctggacgcggccgag
ttcgtgtgggcgccgccgcccgagccgaagaagccggagaagtccgggccggccgaggcg
gagtcggggcactggaacgagctgctcgcgctggtggactgcgtcgtcgacccgcacgtg
aaggacctcatcaaggcgttcgtcgaggacgacgacgtggcggcccggctgcgccgcgcc
cccgccgcgaagaccgtccaccacgcctacccgggcggcctgctcgagcacaccgtctcc
tgcctcaagctggcgcaccggctcgccgaccacttcccgcaggtcgatcgcgacctgctc
gtcgccggcgcgttcttccacgacctcggcaagatccgcgagctgagcggcgaccggagc
accgagtacacggacgagggccggctgatcgggcacctggtcatgaccgcccagtggatc
cacgacaaggcgcgccgcgtgggcgcctcgcgcgacctcgagcaccacgtcgtgcacatg
gtcctctcccaccacgggcgcctcgagtacggctcgcccaaggtgccgatgacgctcgag
gcgatgctcacgcacgccatcgacgagatcgacagccgggtgaactcctggctcaacctg
atgggcaaggacggcggcaaccgccgctggaccgacgcgaacaacgtctacgagcagccg
atctggcgcggcagcctgccgaccgtgcaggcggagaagaagggaccggcgccggagctc
ctcaccccggtcatctacgtgccgcgcaacggcgcgagcgccggcggcggtgcccagccg
cgcccaccgaagaagcccagggatcgcaagcgcgagccgcgcccgcagggcggcgccgcg
gaggcgaagccggccgagggcgccggcgaggcgaaggccgagggcgccccggcggcggcg
caggcgccgcgccccgagggccggcccgagcgcccggatcgcggccagcgcgagcaccgc
ggcttcggcggcggcggcggcggcttcggcgacaagaagcgcggctacaccggcccgcgg
ctgcccggcgacaagggaccgcaccggccgccggagaagaagaacctgacgcacaacccg
ttcgccgcgctcgcgcagaagctcgaggacgccgggaagccggccgaggagaagccggcc
tcgcccgccgaggcggagcagcagcaggcgcccgcccccacgccccccgagccgcaggac
caggcggtggcggcccgcgagcccgacgtcgccccggagcccgctccggccgggacgccc
gctcccgaggacaagccggcggggtag

DBGET integrated database retrieval system