KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3202Help
Entry
A2cp1_3202        CDS       T00833                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00500  Starch and sucrose metabolism
acp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A2cp1_3202
Enzymes [BR:acp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A2cp1_3202
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     A2cp1_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C GHL6 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACL66537
UniProt: B8JGQ0
LinkDB All DBs
Position
complement(3550037..3551755)
Genome map
AA seq 572 aa AA seqDB search
MYLTDSHQGRAGPAGPGRHMAISQRRRAVDPLWFKDAVIYETHVKSFYDSNGDGVGDLRG
LVEKLDYLQDLGITCLWLLPFFPSPLRDDGYDIADYKGIHPDYGTVDDFRQLVAAAHARG
IRVVVELVVNHTSDQHPWFQRARRAPPGSPERAYYVWSDTDERYRDARIIFTDTEKSNWT
WDPEAKQYYWHRFFSHQPDLNFENAVVLGEVLDALRFWAEMGVDGFRLDAVPYLVEQEGT
SCENLPGTHELIRRIRAYVDQHFPGRMLLAEANQWPADVRPYFGEGDECHMAFHFPLMPR
IFMALRLEDVEPIVEIMRRTPAIPDTCQWALFLRNHDELTLEMVTADERDYMYLAYSQDP
RMKLNVGIRRRLAPLVDNSRRRMELLNSLLFSFPGTPIVYYGDELGMGDNIYLHDRNGVR
TPMQWSPDRNAGFSRADPGRLYSAPISDAVYGYQAVNVEAQLRDPSSLLHWMRNTIALRK
LFRAFGRGTMEFLPVQNRKVLAYVRRHDEDVILCVANVSRFAQPAQLDLSHLEGYVPVEM
VGYTEFPRIGRQPYALTLAPYGYFWFELRKPA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttacggactcgcatcagggacgagcgggcccggccggcccggggaggcacatg
gcgatctcgcagcgcaggcgggcggtcgatccgctctggttcaaggacgcggtcatctac
gagacgcacgtgaagtcgttctacgactccaacggcgacggcgtgggcgacctgcgcggg
ctggtggagaagctcgactacctccaggacctcggcatcacctgcctctggctgctgccg
ttcttcccgtcgccgctgcgcgacgacggctacgacatcgccgactacaagggcatccac
cccgactacggcacggtggacgacttccgccagctcgtggccgcggcgcacgcccgcggc
atccgcgtggtggtggagctggtggtgaaccacacctccgaccagcacccctggttccag
cgcgcccggcgcgcgccgcccggctcgccggagcgcgcctactacgtgtggagcgacacc
gacgagcgctaccgcgacgcccgcatcatcttcaccgacaccgagaagtcgaactggacc
tgggatccggaggcgaagcagtactactggcaccgcttcttctcgcaccagccggacctg
aacttcgagaacgccgtggtgctcggcgaggtgctggacgcgctgcgcttctgggccgag
atgggcgtggacggcttccggctggacgcggtgccgtacctggtcgagcaggaggggacg
agctgcgagaacctgcccggcacgcacgagctgatccgccggatccgggcgtacgtggac
cagcacttccccggccgcatgctgctcgccgaggcgaaccagtggccggccgacgtgcgc
ccgtacttcggcgagggcgacgagtgccacatggcgttccacttcccgctcatgccgcgc
atcttcatggcgctgcggctcgaggacgtggagcccatcgtcgagatcatgcgccgcacc
ccggccattccggacacctgccagtgggcgctgttcctgcgcaaccacgacgagctgacg
ctggagatggtgaccgccgacgagcgcgactacatgtacctcgcgtacagccaggacccg
cgcatgaagctgaacgtcgggatccggcgccggctcgcgccgctggtggacaacagccgc
cggcgcatggagctgctcaactcgctcctgttctcgttcccggggacgcccatcgtctac
tacggcgacgagctcggcatgggcgacaacatctacctccacgaccgcaacggcgtgcgc
acgcccatgcagtggagcccggaccggaacgccggcttctcccgcgccgatcccggccgg
ctctactccgcgcccatctccgacgcggtgtacgggtaccaggcggtgaacgtcgaggcc
cagctgcgcgacccgtcctcgctgctgcactggatgcggaacacgatcgcgctgcggaag
ctgttccgggcgttcgggcgcggcaccatggagttcctgccggtgcagaaccgcaaggtg
ctcgcctacgtccgccgccacgacgaggacgtgatcctgtgcgtggcgaacgtgtcgcgc
ttcgcccagccggcgcagctcgacctctcccacctcgagggctacgtgccggtggagatg
gtcgggtacaccgagttcccgcgcatcgggcggcagccctacgcgctgacgctcgcgccg
tacggctacttctggttcgagctgcgcaagcccgcctga

DBGET integrated database retrieval system