KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3527Help
Entry
A2cp1_3527        CDS       T00833                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A2cp1_3527
Enzymes [BR:acp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A2cp1_3527
Transporters [BR:acp02000]
 Other Transporters
  Pores ion channels [TC:1]
   A2cp1_3527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACL66857
UniProt: B8J5J5
LinkDB All DBs
Position
3940946..3941551
Genome map
AA seq 201 aa AA seqDB search
MKLYYAPRTRATRPRWLLEEMGVPYELVRLDRAAGALRTPEHLARHPMGRVPVLEDGDAR
LFESAAICLWLAERFPEKGMLPPAGTPGRALTYQWLFFAMDELEPPLEALHGLLRPPEGE
RDAAAIEAQKARFLEGARVLDLALRGRPFLAGDAFGVADLVTGAVASWGKALVGGIDGMP
ALAAWLAGVKARPAWKRAIAD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacgcgccgcgcacgcgggccacccgcccccgctggctgctcgaggag
atgggcgttccctacgagctggtccggctcgatcgcgccgccggggcgctgcgcacgccc
gagcacctcgcccgccacccgatgggccgcgtgccggtcctggaggacggcgacgcccgc
ctcttcgagtcggccgccatctgcctgtggctcgccgagcgcttcccggagaagggcatg
ctcccgccggccggcacgccgggccgcgcgctcacctaccagtggctgttcttcgccatg
gacgagctggagccgccgctcgaggcgctgcacgggctgctccgtccgcccgagggcgag
cgcgacgcggcggccatcgaggcccagaaggccaggttcctggagggcgcgcgcgtcctc
gacctggcgctccggggccgcccgttcctcgccggcgacgcgttcggcgtggccgacctc
gtcaccggcgccgtggcctcctggggcaaggcgctggtgggcggtatcgacgggatgccg
gcgctggcggcctggctcgccggcgtgaaggcgcggcccgcctggaagcgggccatcgcc
gactga

DBGET integrated database retrieval system