KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3950Help
Entry
A2cp1_3950        CDS       T00833                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:acp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A2cp1_3950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acp01002]
    A2cp1_3950
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acp01011]
    A2cp1_3950
Enzymes [BR:acp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A2cp1_3950
   3.4.21  Serine endopeptidases
    3.4.21.-  
     A2cp1_3950
Peptidases [BR:acp01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   A2cp1_3950
Peptidoglycan biosynthesis and degradation proteins [BR:acp01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   A2cp1_3950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11 HEAT_2
Motif
Other DBs
NCBI-ProteinID: ACL67273
UniProt: B8J8I7
LinkDB All DBs
Position
4400944..4403175
Genome map
AA seq 743 aa AA seqDB search
MQPTVPSSSRPLFPPALLAAALAAAVVPAAALAAPPPPVPTADAPSREAARALTAIVDGS
PLAGARVGILVSAIDTGEVVYARDPDVLLNPASNVKLVTSAAALARLGPEYRFATEVLAE
PKGGAARALYVRGKGDPSIVTERLWAMAGDLQHLGVKRVGELVVDEGFFDGERTGPGYDQ
EEGDRAYLAPAGALSLNFNAVAVHVGPGDRRGARGRVELEPASDYLEIENRTTTVRAGSP
RRVIIESVARGGKQRIVVKGRVPLGSRVQPQWRRIEDPALYLGHTLARLLELRGVKVGKV
RAGATPEGARLVLVAQSDPLGELVRRLNKTSNNFVAEQLLKTLGAEVKGAPGTWPKGVQV
VEEFLAEAGVPRGTYVMKNGSGLNDTNRFSARQLVTLLRAMYARFPLQPEYLSSLPVAGR
DGTIRWRMEGTEAAGRLRAKTGTLENVTSLSGYVEDGAHRTLAFAVLVNDYPGRSAGVRR
AVDALGAALAASGGPPAGLAAAVAQGKEPGPAAVVPVAATLDLARSAQPYYALARTGDPR
NEPFLRGALRAESDPALRLAIAEAVYLSDPEGEAARRSFLDQVTPDARVLGRLWSALGTE
EPPPVVPSLAELAGEGVPEALAKLVELAPAAALDGALAARLAEALAGVAASAPDELVQAL
RAARASDADAAVGALGAGLARSDEREHPFPPALAALAGRQDELGAYARTLGPRLEEARHA
AEAVRAAPALVPVGGTVVPASGR
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccaccgtgccctcctcctcccgtcccctcttcccgcccgccctgctcgccgcg
gcgctcgccgccgccgtcgtccccgccgccgcgctcgccgcgcctccgcccccggtgccc
accgccgacgcgccgtcccgcgaggccgcccgcgcgctcaccgcgatcgtggacggctcg
ccgctcgccggcgcgcgggtcgggatcctcgtctcggcaatcgacacgggcgaggtggtc
tacgcgcgcgaccccgacgtcctgctcaacccggcgtccaacgtgaagctggtgacgagc
gccgccgcgctggcgcggctcgggcccgagtaccgattcgcgaccgaggtcctggccgag
ccgaagggtggcgcggcgcgggcgctctacgtgcggggcaagggcgatccctcgatcgtg
accgagcggctctgggccatggcgggcgacctccagcacctcggcgtgaagcgcgtcggc
gagctggtggtggacgagggcttcttcgacggcgagcggaccgggcccggctacgaccag
gaggagggcgatcgcgcgtacctcgcgcccgccggcgcgctgtcgctcaacttcaacgcg
gtggcggtgcacgtcggaccgggcgaccggcgcggcgcgcgcggccgggtggagctcgag
cccgccagcgactacctcgagatcgagaaccgcaccaccaccgtgcgcgcgggctcgccg
cggcgagtgatcatcgagtcggtcgcgcgcggcggcaagcagcggatcgtggtgaagggg
cgcgtgccgctcggcagccgggtgcagccgcagtggcgccgcatcgaggacccggcgctc
tacctcggccacacgctggcgcggctgctcgagctgcgcggggtgaaggttgggaaggtg
cgcgccggcgcgacgcccgagggcgcgcggctggtgctcgtggcgcagtcggacccgctc
ggcgagctcgtgcgccggctcaacaagacctcgaacaacttcgtggccgagcagctcctg
aagacgctcggcgccgaggtgaagggcgcgcccgggacctggccgaagggcgtgcaggtg
gtggaggagttcctggccgaggccggcgtgccgcgcggcacgtacgtcatgaagaacggc
tcgggcctgaacgacacgaaccgcttcagcgcccggcagctcgtgacgctgctccgcgcc
atgtacgcgcggttcccgctccagcccgagtacctctcctcgctgccggtggccggccgc
gacggcaccatccgctggcggatggagggcaccgaggccgccggccggctccgcgccaag
accggcacgctcgagaacgtcaccagcctctccggctacgtggaggacggcgcgcaccgg
acgctcgcgttcgcggtgctggtgaacgactacccgggccgctccgccggcgtgcgccgc
gccgtcgacgcgctcggcgccgcgctggccgcgagcggcggcccgccggcgggcctcgcg
gcggcggtggcgcagggcaaggagccggggccggcggccgtcgtgccggtcgccgcgacg
ctggacctcgcgcgctcggcgcagccgtactacgcgctcgcccgcaccggcgacccgcgc
aacgagccgttcctgcgcggcgcgctgcgggccgagagcgaccccgcgctccggctcgcc
atcgccgaggcggtgtacctgtccgaccccgagggcgaggcggcgcggcggagcttcctc
gaccaggtcacccccgacgcgcgcgtcctcgggcggctctggtcggccctggggaccgag
gagccgccgccggtcgtcccctccctcgccgagctcgccggcgagggcgtgccggaggcg
ctcgcgaagctggtcgagctcgcgcccgccgccgcgctcgacggtgcgctcgcggcccgc
ctcgccgaggcgctcgccggcgtggccgcgtccgcgcccgacgagctcgtccaggcgctc
cgggccgcgcgggcgtccgacgcggacgccgccgtcggcgcgctcggcgccgggctggcg
cgcagcgacgagcgcgagcaccccttcccgcccgcgctcgccgcgctcgccggccggcag
gacgagctcggggcctacgcccgcacgctaggcccacggctcgaggaggcccgccacgcc
gccgaggcggtccgcgccgcgccggcgctcgtgcccgtcggcgggacggtcgtgccggcc
tccgggcggtag

DBGET integrated database retrieval system