KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4312Help
Entry
A2cp1_4312        CDS       T00833                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp03030  DNA replication
acp03410  Base excision repair
acp03420  Nucleotide excision repair
acp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    A2cp1_4312
   03410 Base excision repair
    A2cp1_4312
   03420 Nucleotide excision repair
    A2cp1_4312
   03430 Mismatch repair
    A2cp1_4312
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acp03032]
    A2cp1_4312
   03400 DNA repair and recombination proteins [BR:acp03400]
    A2cp1_4312
Enzymes [BR:acp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A2cp1_4312
    6.5.1.6  DNA ligase (ATP or NAD+)
     A2cp1_4312
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     A2cp1_4312
DNA replication proteins [BR:acp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    A2cp1_4312
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     A2cp1_4312
DNA repair and recombination proteins [BR:acp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     A2cp1_4312
   NER (nucleotide excision repair)
    Other NER factors
     A2cp1_4312
   MMR (mismatch exicision repair)
    Other MMR factors
     A2cp1_4312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACL67629
UniProt: B8JBM1
LinkDB All DBs
Position
complement(4804641..4806182)
Genome map
AA seq 513 aa AA seqDB search
MLLAELAEVSRAVAATPARLEKIARLAEALRRLAPDERAVGASWLAGDLPGGRIGIGGAT
VRAALDAAPAEGGGPGLTVAEVDAALGRIATASGAGSAGARRRELDALLARAGAPERWFL
AALLLGELRQGALEGVLADAVARAAGLPAAEVRRAAMLAGALPPVAVAALSEGAAGLARF
RLRVGEPVSPMLAQTAADVEEALRALGGEAALEWKLDGARIQAHRDGGEVRVFSRSLRDV
TAAVPEVVALLRAAPEPRLVLDGEAIALRADGTPEPFQVTMRRFGRRLDVERLAPDLPLT
AFFFDALVAGGAELLASPERVRWAALERAVPAEQRVPRLVTRDPAEAGAFLEDALARGQE
GVVAKALDAPYEAGRRGAAWLKVKRAHTLDLVVLAAEWGSGRRRGWLSNLHLGARDPSTG
GFVMLGKTFKGMTDAMLAWQTERLKALATGPLDAWQVPVRPELVVEVAFDGIQSSPRYPG
GLALRFARVKRYREDKRPEDADTIETVRGLYGG
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctcgccgagctcgccgaggtctcccgcgccgtggccgccaccccggcgcgcctc
gagaagatcgcgcgcctcgccgaggcgctccgccggctcgcgccggacgagcgcgcggtg
ggcgcgagctggctcgcgggcgacctgcccggcgggcgcatcgggatcggcggcgccacc
gtgcgggccgcgctcgacgcggcgccggcggagggcggcgggccggggctcacggtggcg
gaggtggacgcggcgctgggccgcatcgcgaccgcgtccggcgcgggctcggccggcgcc
cgtcgccgggagctcgatgcgctgctcgcccgggccggcgcccccgagcgctggttcctg
gcggcgctcctcctcggcgagctgcggcagggcgcgctggagggcgtgctcgccgacgcg
gtggcgcgggccgcggggctccccgcggccgaggtccggcgcgccgccatgctcgccggc
gcgctcccgccggtcgcggtcgcggcgctctcggagggcgccgccggcctggcgcgcttc
cggctgcgggtgggcgagcccgtgtcgcccatgctggcgcagaccgcggcggacgtggag
gaggcgctccgggcgctcggcggcgaggccgcgctggagtggaagctggacggcgcgcgg
atccaggcgcaccgcgacggcggcgaggtgcgcgtgttctcccgctcgctgcgcgacgtg
accgcggccgtgcccgaggtggtggcgctcctgcgcgccgcgcccgagccgcggctcgtg
ctcgacggcgaggccatcgcgctccgcgccgacggcacgcccgagccgttccaggtcacc
atgcgccgcttcggccggaggctggacgtggagcgcctcgcgcccgatctgccgctcacc
gcgttcttcttcgacgcgctggtggccggcggcgcagagctgctggcgagcccggagcgc
gtgcgctgggccgcgctcgagcgcgccgtcccggcggagcagcgcgtcccgcggctcgtc
acccgcgatcccgccgaggccggcgcgttcctcgaggacgcgctcgcccgcggtcaggag
ggcgtggtggcgaaggcgctcgacgcgccttacgaggccggccgccgcggcgcggcgtgg
ctgaaggtgaagcgcgcgcacacgctcgacctggtggtgctcgccgcggagtggggcagc
ggccggcgccgcggctggctctccaacctgcacctcggcgcgcgcgacccatccaccgga
ggcttcgtcatgctcggcaagacgttcaagggcatgaccgacgccatgctcgcgtggcag
accgagcggctgaaggcgctcgccacgggtcccctcgacgcctggcaggtcccggtgcgc
cccgagctggtggtggaggtcgcgttcgacgggatccagtccagcccgcgctaccccggc
ggcctcgccctccgcttcgcgcgcgtgaagcgctaccgcgaggacaagcgccccgaggac
gcggacacgatcgagacggtgcgggggttgtacggagggtga

DBGET integrated database retrieval system