KEGG   Actinomyces sp. oral taxon 414: AM609_02610
Entry
AM609_02610       CDS       T04083                                 

Definition
(GenBank) ATP synthase F0F1 subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
acq  Actinomyces sp. oral taxon 414
Pathway
acq00190  Oxidative phosphorylation
acq01100  Metabolic pathways
Module
acq_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:acq00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AM609_02610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:acq00194]
    AM609_02610
Enzymes [BR:acq01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     AM609_02610
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     AM609_02610
Photosynthesis proteins [BR:acq00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   AM609_02610
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N AAA_25 TniB
Other DBs
NCBI-ProteinID: ALC98648
UniProt: A0A0M4GK84
LinkDB
Position
643906..645540
AA seq 544 aa
MVELTIRPEDVRSALDEFVASYKPSQVAAEEVGHVVFAADGIAHVEGLPGVMANELLVFE
DRTAGLAMNLDERQIGVVVLGDFAGIDEGQTVRRTGEVLSVPVGDGYLGRVVDPLGRPID
GLGQIRTEGRRALELQAPGVMSRKSVHEPLQTGLKAIDSMIPIGRGQRQLIIGDRKTGKT
AIALDTILNQKSAWETGDPAQQVRCIYVATGQKGSTIASVRAVLEERGALEYTTIVASPA
SDPAGFKYLSPYTGSAIGQHWMYSGKHVLIVFDDLSKQAEAYRAVSLLLRRPPGREAYPG
DVFYLHSRLLERCAKLSDDLGAGSMTGLPIIETKANDVSAYIPTNVISITDGQIFLQSDL
FNADQRPAVDVGISVSRVGGAAQVKAMKKVAGTLKLTLAQYRSMQAFAMFASDLDAATRA
QLTRGERLMELLKQPQFTPYPVEEQVASVWTGTNGYLDDLDVADVLPFERALLDHLRRNT
KVLDAIRTTGLLSDDDEAALRAAVESFRSTYLAGGKMLSGEVAAAEEEAPAEHTAEQIVL
KKKG
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggtggaactgaccatcaggccggaggacgtccgttcggccctggacgagttcgtcgcg
tcctacaagccctcgcaggtcgcggccgaggaagtcgggcacgtcgtcttcgccgccgac
ggcatcgcccacgtcgagggactgcccggcgtcatggccaatgaactgctcgtcttcgag
gaccgcaccgccggactggccatgaacctcgacgagcgccagatcggcgtggtcgtcctg
ggcgacttcgccggcattgacgagggccagacggtgcggcgcaccggggaggtcctgtcc
gtgccggtgggagacggctacctgggccgcgtcgtcgaccccctgggccgccccattgac
ggcctgggccagatccgcaccgaggggcggcgcgccctggagctccaggcccccggcgtc
atgtcccgcaagtccgtccacgagccccttcagacggggctcaaggccattgactccatg
atccccatcggccgcggccagcgccagctcattatcggcgaccgcaagaccggcaagacg
gccatcgccctggacaccatcctcaaccagaagtcggcctgggagacgggcgaccccgcc
cagcaggtgcgctgcatctacgtggccaccgggcagaagggctccaccatcgcctccgtg
cgcgccgtcctggaggagcgcggcgccctggagtacaccaccattgtggcctccccggcc
tccgacccggccggcttcaagtacctgtccccctacaccggctcggccatcggccagcac
tggatgtactcgggcaagcacgtactcatcgtcttcgacgacctgtccaagcaggccgag
gcgtaccgggccgtctccctgctcctgcgccgcccgccgggccgcgaggcctacccgggc
gacgtcttctacctgcactcgcgcctgctggagcgctgcgccaagctctccgacgacctg
ggggccgggtccatgaccggtctgccgatcatcgagaccaaggccaatgacgtctcggcc
tacatccccaccaatgtcatctccatcaccgacgggcagatcttcctccagtccgacctg
ttcaacgccgatcagcgccccgccgtcgatgtgggcatctcggtgtcgcgcgtgggcggg
gcggcccaggtcaaggccatgaagaaggtcgccggcaccctcaagctcacgctggcgcag
taccgctccatgcaggccttcgccatgttcgcctccgacctggacgccgccacccgcgcc
cagctcacccgcggcgagcgcctcatggagctgctcaagcagccccagttcacgccctac
ccggtcgaggagcaggtggcgagcgtgtggaccggcaccaacggctacctcgacgacctc
gacgtggccgacgtcctgcccttcgagcgcgccctgctggaccacctgcggcgcaatacc
aaggtcctggacgccatccgcaccaccggcctgctctccgacgacgacgaggccgccctg
cgcgccgccgtcgagtccttccgcagcacctacctggccgggggcaagatgctctccggc
gaggtcgccgccgccgaggaggaggcccccgccgagcacacggccgagcagatcgtgctc
aagaagaagggctga

DBGET integrated database retrieval system