KEGG   Actinomyces sp. oral taxon 414: AM609_04710
Entry
AM609_04710       CDS       T04083                                 

Definition
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
acq  Actinomyces sp. oral taxon 414
Pathway
acq00770  Pantothenate and CoA biosynthesis
acq01100  Metabolic pathways
acq01240  Biosynthesis of cofactors
Module
acq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:acq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AM609_04710
Enzymes [BR:acq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     AM609_04710
SSDB
Motif
Pfam: CTP_transf_like DUF987
Other DBs
NCBI-ProteinID: ALC98962
UniProt: A0A0M3RJL6
LinkDB
Position
1153014..1153526
AA seq 170 aa
MTLAVYPGTFDPITLGHVDVVTRARTVFDRVVVGVAHNAAKRGRHLFDLDERLELARACL
AHLSGVDVDVVPGLLADYCRERGAEAIIKGLRNGTDLDAEVPMALLNRDLGGPETVFLAA
AGPHAHVSSSLVKDVAGHGGDVSGLVPDVVLAALERELAPAAARRSAGRP
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacgctcgccgtgtaccccggaaccttcgacccgatcaccctcgggcacgtcgacgtc
gtcactcgcgcccgcaccgtcttcgaccgggtcgtcgtcggcgtcgcccacaacgccgcc
aagcgcggccgccacctgttcgacctcgacgagcgcctggaactggcccgcgcctgcctg
gcccatttgagcggggtggacgtcgacgtcgtccccggactcctggccgactactgccgc
gagcgcggggcggaggcgatcatcaagggcctgcgcaacggcacggacctggacgccgag
gtccccatggcgctgctcaaccgcgatctgggcgggccggagacggtcttcctggccgcc
gccggcccccacgcccacgtctcctcctccctggtcaaggacgtggccgggcacggcggc
gacgtgtccgggctcgtgcccgacgtcgtgctggcggccctcgagcgcgagctcgccccc
gccgcggcccgccggtcggccgggcgcccctga

DBGET integrated database retrieval system