KEGG   Actinomyces sp. oral taxon 414: AM609_05745
Entry
AM609_05745       CDS       T04083                                 

Definition
(GenBank) aldose epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
acq  Actinomyces sp. oral taxon 414
Pathway
acq00010  Glycolysis / Gluconeogenesis
acq01100  Metabolic pathways
acq01110  Biosynthesis of secondary metabolites
acq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM609_05745
Enzymes [BR:acq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AM609_05745
SSDB
Motif
Pfam: Aldose_epim YAcAr
Other DBs
NCBI-ProteinID: ALC99107
UniProt: A0A0M5JJK5
LinkDB
Position
1412693..1413583
AA seq 296 aa
MSIPDETSRTPTPSLAPRLPRTAALGPGRGGLPRLLVDAAAGGGEIYLHGAHLTSWRPRG
GEEVVFTSRRAVFDGVHAIRGGVPICAPWFAGGVDGESSPAHGWARIRPWELRSAQATAS
GGVRALFALEHDGLSLLYEVGIGEELSLDLSLRNAGGAPRTVEAALHTYLAVGDVTAVSI
TGLEGARYSDRLTDEERVQDGPIRFSGRVDRIYRARGPVAVTDPAGRRRIVVTGVRAPNA
VVWNPWNRVAATMADLGEEWPSMVCVESAAVRDQAVRLEPGESMSLGARIGVEPLS
NT seq 891 nt   +upstreamnt  +downstreamnt
atgagcatcccagatgagacgagtcgaaccccgaccccttcgctcgcgccccgcctgccg
cgcaccgccgccctcggacccggccgcgggggcctgccccgcctcctggtcgacgccgcc
gccggcggcggtgagatctacctccacggggcgcatctgacgtcgtggcgcccccgcggc
ggcgaggaggtcgtcttcacctcgcgccgggccgtcttcgacggcgtgcacgccatccgc
gggggcgtgccgatttgcgcgccctggttcgccgggggagtcgatggggagagctccccc
gcgcacggctgggcccggatccggccctgggagctgcgcagcgcgcaggccactgcctcc
ggcggcgtgcgcgccctgttcgccctggagcacgacgggctgtccctgctctacgaggtc
ggcatcggtgaggagctgagcctggacctgtccctgcgcaacgcgggcggcgcgccgcgc
actgtggaggccgccctgcacacctacctcgccgtcggcgacgtcaccgcggtgtcgatc
accggcctggagggggcccgctactccgaccggctcaccgatgaggagcgggtgcaggac
gggcccatccgcttctccgggcgcgtggaccgcatctaccgggcccgggggcccgtggcc
gtgacggacccggccggccggcggcgcatcgtcgtcaccggggtccgcgcgcccaacgcc
gtggtgtggaacccgtggaacagggtcgccgcgaccatggcggacctgggggaggagtgg
ccctccatggtttgcgtcgagtccgcggcggtgcgcgaccaggccgtgcgcctggagccg
ggggagtcgatgtcactgggcgcgcgcatcggggtcgagccgctctcctga

DBGET integrated database retrieval system