KEGG   Actinomyces sp. oral taxon 414: AM609_07020Help
Entry
AM609_07020       CDS       T04083                                 

Definition
(GenBank) sulfurtransferase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
acq  Actinomyces sp. oral taxon 414
Pathway
acq00040  Pentose and glucuronate interconversions
acq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AM609_07020
Enzymes [BR:acq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     AM609_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ALC99300
UniProt: A0A0M4GTQ0
LinkDB All DBs
Position
complement(1712703..1713737)
Genome map
AA seq 344 aa AA seqDB search
MKAVVLEKQHVISVREVPADLVCGPGQLRIAPHTVGICGSDVHYYTHGRIGRYVVEAPMI
LGHEASGVVREVGEGVEGFAVGDRVAMEPGVPDTGSRAALAGMYNVDPAVRFWATPPVDG
CLVEEVIHPAAFTYHLPDNVSFAEGALMEPLAVGMHAATKARIRPGDVTAVSGAGTIGLL
TAAAALAGGASKVIISDVSPVKLEIASRIPGTLTVDGREHRLLDVVGEQTAGWGADVVFE
CSGHPSAYADLWRIGAPGNRTVLVGIPVDPVPVDVTEVQARETTIESVFRYANVYQRAID
LVAAGKIDLTPFITQTFDMDHAVDAFERVAEGRPGDVKIQITVG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcgtccttgagaagcagcacgtcatcagcgtccgcgaggtccccgccgac
ctcgtctgcgggcccgggcagctgcgcatcgccccgcacaccgtcggcatctgcggctcc
gacgtccactactacacgcacgggcgcatcgggcgttatgtcgtcgaggcgcccatgatc
ctgggccacgaggcctccggcgtggtgagggaggtcggcgagggcgtggagggcttcgcc
gtgggcgaccgcgtggccatggagcccggcgtgcccgacaccggctcgcgcgccgccctg
gccggcatgtacaacgtcgaccccgccgtccgcttctgggccaccccgccggtggacggc
tgcctcgtcgaggaggtcatccacccggccgccttcacctaccacctgcccgacaacgtc
tccttcgccgagggcgccctcatggagcccctcgccgtcggcatgcacgccgccaccaag
gcccgcatccgccccggcgacgtcaccgccgtctcgggcgccggcacgatcggcctgctc
accgccgccgcggccctggctgggggcgcctccaaggtcattatctccgacgtctccccg
gtcaagctggagatcgcctcccgcatccccggcactctcaccgtcgacgggcgcgagcac
cggctcctcgacgtcgtgggcgagcagaccgccggctggggcgccgacgtcgtcttcgag
tgctccggccaccccagcgcctacgccgacctgtggaggatcggcgcgcccggcaaccgg
accgtcctcgtgggcatccccgtggaccccgtgcccgtcgacgtcaccgaggtgcaggcg
cgcgagacgaccatcgagagcgtcttccgctacgccaatgtctaccagcgcgccatcgac
ctggtggccgccgggaagatcgatctgacgcccttcatcacgcagaccttcgacatggac
cacgccgtcgacgccttcgagcgcgtcgccgagggccgtcccggcgacgtcaagatccag
atcaccgtcggctga

DBGET integrated database retrieval system