KEGG   Actinomyces sp. oral taxon 414: AM609_09215Help
Entry
AM609_09215       CDS       T04083                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acq  Actinomyces sp. oral taxon 414
Pathway
acq00010  Glycolysis / Gluconeogenesis
acq00030  Pentose phosphate pathway
acq00051  Fructose and mannose metabolism
acq00052  Galactose metabolism
acq00680  Methane metabolism
acq01100  Metabolic pathways
acq01110  Biosynthesis of secondary metabolites
acq01120  Microbial metabolism in diverse environments
acq01130  Biosynthesis of antibiotics
acq01200  Carbon metabolism
acq01230  Biosynthesis of amino acids
acq03018  RNA degradation
Module
acq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM609_09215
   00030 Pentose phosphate pathway
    AM609_09215
   00051 Fructose and mannose metabolism
    AM609_09215
   00052 Galactose metabolism
    AM609_09215
  09102 Energy metabolism
   00680 Methane metabolism
    AM609_09215
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AM609_09215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:acq01009]
    AM609_09215
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:acq03019]
    AM609_09215
Enzymes [BR:acq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AM609_09215
Protein phosphatases and associated proteins [BR:acq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AM609_09215
Messenger RNA biogenesis [BR:acq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AM609_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ALC99610
UniProt: A0A0M4GLY9
LinkDB All DBs
Position
2260153..2262519
Genome map
AA seq 788 aa AA seqDB search
MPADTPPTEAADTSPAPTAPAPPPEPVRIGVLTSGGDAQGMNAAVRAVVRAALRMGAQPY
AVMEGWAGAVAGGDSIHPLQWDSVGSILHRGGTLIGTARSAEFREREGQLAAARNLLEHG
IDRLVVIGGDGSLTGTDAFRTNWPGLVAELAERGEISPETAAAHPALMVTGLVGSIDNDL
VGADMTIGTDSALHRILEAIDDISSTAASHQRTFIIEVMGRHCGYLALMAAVAGGCDYVL
VPELPPAGGWEEDMCRKLAKGREAGRRESMVVVAEGATDRSGNRISADDVKRVLAERLGE
DARVTILGHVQRGGKPSAYDRWMSTLLGCAAAREMIVATPQTEPVIIAERHNRISRLPMM
EQIRATRAVKDLVAGGDYEGAVAARGASFGEMLRIFETMSTPPELDPEVAAARDQAGAVS
KRVAIIHAGGLAPGMNTAARAAVRLGLDHGFTMLGVYGGFPGLLDGNVRELSWDDVEGWV
GDGGAQLGTRREVPTIEQLYALGRAIESHEIDALLIIGGYNAYLSAYELVSERPRYPAFK
IPIICVPASIDNNLPGSELSIGADTALNNAVGALDSIKQSAAASHRCFVAESMGRKCGYM
ALMSGIATGAERVYLHEDGLTLAQLARDSARMVESFRSGRQLYLVIRNERASENYTLDVL
AKIFAQEGRGLYDVRHAAIGHLQQGGDPSAFDRIMATKLVAHALGLLADQLKAGTHHSSY
VGLTGGRITHHRLEHMNDELDLDSRRPLHQWWMGLREAIALVSQNAGVIPLENIPDFGAS
VNAAAASD
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgacacgccccccaccgaagccgccgacacctcccccgcgcccaccgcgccc
gcaccaccgccggagccggtgcgcatcggcgtcctgacctccggcggcgacgcccagggc
atgaacgcggccgtgcgcgccgtcgtgcgcgccgccctgcgcatgggcgcccagccctac
gccgtcatggagggctgggccggcgccgtcgccgggggcgacagcatccacccgctccag
tgggactcggtcggatcgatcctccaccgcggcggcaccctcatcggcaccgcccgctcc
gccgagttccgcgagcgcgagggccagctggccgccgcccgcaacctcctggagcacggc
atcgaccgcctcgtcgtcatcggcggcgacgggtccctgaccggcaccgacgcgttccgc
accaactggcccggcctggtcgccgagctggccgagcgcggcgagatctcccccgagacg
gccgcggcccaccccgcgctcatggtgaccggcctcgtcggcagcatcgacaacgacctg
gtcggcgcggacatgaccatcggcaccgactccgccctgcaccgcatcctggaggcgatc
gacgacatctcctccaccgcggcctcccaccagcgcaccttcatcatcgaggtcatgggc
cgccactgcggctacctggccctcatggcggcggtggccggcggctgcgactacgtgctg
gtgcccgagctcccgcccgccggcggctgggaggaggacatgtgccgcaagctcgccaag
ggccgggaggccgggcgccgcgagtccatggtcgtcgtcgccgagggcgccaccgaccgg
tccggcaaccgcatctccgccgacgacgtcaagcgcgtcctggccgagcggctgggcgag
gacgcccgcgtgacgatcctgggccacgtccagcgcggtggcaagcccagcgcctacgac
cggtggatgtcgaccctgctgggctgcgccgccgcccgcgagatgatcgtcgccaccccg
cagacagagccggtcatcatcgccgagcgccacaaccggatcagccgcctgcccatgatg
gagcagattcgcgccacgcgcgcggtcaaggacctcgtggccggcggggactacgagggg
gcggtggccgcccgcggcgcgagcttcggggagatgctgcggatcttcgagaccatgtcc
actccccccgagctcgaccccgaggtcgccgccgcgcgcgaccaggcgggcgccgtctcc
aagcgggtcgccatcatccacgcgggcgggctggcgccgggcatgaacacggcggcgcgg
gccgcggtgcgcctgggcctggaccacggcttcaccatgctgggggtctacgggggcttc
ccgggactcctggatgggaatgtgcgcgagctgagctgggacgacgtcgagggctgggtc
ggcgacggcggcgcccagctcggcacgcggcgcgaggtccccaccattgagcagctctac
gcgctggggcgcgccatcgagtcccacgagatcgacgccctgctcatcatcggcgggtac
aacgcctacctgtccgcctacgagctggtctccgagcggccccgctaccccgccttcaag
atcccgatcatctgcgtgcccgcctcgatcgacaacaacctgcccggcagcgagttgagc
atcggcgcggacacggccctgaacaacgccgtgggcgcactggactcgatcaagcagtcg
gcggcggcctcgcaccgctgcttcgtggccgagtccatgggccgcaagtgcggctacatg
gccctcatgagcggcatcgccaccggggccgagcgcgtctacctccacgaggacggcctc
accctggcccagctcgcccgcgactcggcgcgcatggtggagtccttccgctcgggccgc
cagctctacctggtgatccgcaacgagagggcgagcgagaactacaccctggacgtgctc
gccaagatcttcgcccaggagggccgcggcctgtacgacgtgcgccacgccgccatcggc
cacctccagcagggcggcgacccgtcggccttcgaccgcatcatggccaccaagctcgtg
gcccacgccctgggcctgctggccgaccagctgaaggcgggcacccaccactccagctac
gtggggctcacgggcgggaggatcacccaccaccgcctggagcacatgaacgacgagctg
gacctggactcgcgccgccccctgcaccagtggtggatgggcctgcgcgaggccatcgcc
ctggtcagccagaacgccggcgtcatccccctggagaacatccccgacttcggcgcgtcg
gtgaacgccgcggccgcctcggactga

DBGET integrated database retrieval system