KEGG   Actinomyces sp. oral taxon 414: AM609_14470
Entry
AM609_14470       CDS       T04083                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
acq  Actinomyces sp. oral taxon 414
Pathway
acq00620  Pyruvate metabolism
acq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AM609_14470
Enzymes [BR:acq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     AM609_14470
SSDB
Other DBs
NCBI-ProteinID: ALD00334
UniProt: A0A0M4H7Y9
LinkDB
Position
complement(3585343..3588837)
AA seq 1164 aa
MSTTSTDASTARHPFDPGRRSADAATINSAIALRLELLGMPAPTGIGDPRTDRLMSPILA
RQREMTRRLSGRLCAADRRIQAFLDSYLDGAAARPRLPAATFVLDQPGLARALSLPLDAT
SFTSPYVESYRVLQGVLHNPRNDRRTTAGVFHIAEGGLPIPDDKKAVPRDVFARVLAAAL
NAPADLLTLPWTSTRPDPARCFVSLLLRPVVVPEVPGVTGERSMEIRFIAPGGLVSNLDF
VEGIFGNGGDPYLPENDASLAPETWTGHTGCVILAPHLTALTKKELGLPAWEEADERRRR
DGMCWREEDELYNDGKPFKLVARDERGVIVTVIADNYYGYCKKEVKTQIGYSANLFGCVE
EEHSGGAIAFPRYDLGREFRDVHTPADRTLDDVLAANPGRFRREDSGCAVDLDDETIVLV
PGGAFYSMLTQTITWTGADGETARIPLLAGRTYVTPSGYRIHCKAAIGNPKQWHMIGTAP
WHTQLHKPATVSGGGKSEISKSILDAIVFGEAYIGDVEADLDAVQGILDGDYADRFVDPA
NKSAHHRSILSERRSLGSVIKLLTPSEMYTREYNAFLESIPPHIKELIFTVKRYYRPEWG
ADWRSHFSVGMMNGRQGNSLRLDGDTVKINMLRVGFESDGAWRLFSLRPDFAACAKVQTE
DDITASLVAPASADDPAFARGLSRKYVTNCEELLFQRPDDAIVPGYDKQTESDMAGTDLF
ISNYAPLTPADARAMVDDAPGLSRFTEPMQGLVRRAAALPEAPEPARRSYWVCTANPRLV
NGAPTRNPRYLQVRPDVARPEEVRLAEVATHLYSRVPLGEPIRHSVDVVAAGRRNNPPEP
GVPALCAYNPLHYMELPELFMEFISSMTGKSPSTTGAGSEGALTKSPFNALPPVYDLNAS
LLSYALGGYDGWLSSAGYIGPRVRVAHDISLLVPEVFSRMTEAERDARALIAGGYLERLE
DREIGGRTVQASRLGYRMNQAFANSFFGRIFLHPDVVFTEEMLRPELQDEEVFADSVDVI
VTTHRVVAQHYVDDGSIRWAVPPLRALLEIMHSGRSEQGWTLASPQFRALFERENILASD
WYAARIDAKVERDRKQAEASIRSLTRFTTTPGNEGVTERLDVGARLEAARAHLAEAASPA
ARERLVGTLGLQPELAEGAPIDVA
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgagcacgaccagcaccgacgcgtccaccgcccgccatcccttcgaccccggccggcgc
agcgccgatgcggcgaccatcaactccgccatcgccctgcgcctggagctgctgggcatg
cccgcccccaccgggatcggcgacccgcggaccgaccggctcatgtcccccatcctggcg
cgccagcgcgagatgacccggcgcctgtcgggccgcctgtgcgccgccgaccggcgcatc
caggccttcctcgactcctacctcgacggcgccgccgcccgtccgcgcctgcccgccgcc
accttcgtgctcgaccagccgggcctggcccgcgccctgtccctgcccctggatgcgacc
agcttcacctccccctacgtcgagagctaccgcgtcctccagggggtcctgcacaatccg
cgcaacgaccggcgcaccacggccggcgtcttccacatcgccgagggcggcctgcccatc
cccgacgacaagaaggccgttccccgcgacgtcttcgcccgcgtcctggccgcggccctg
aacgcccccgcggacctgctcaccctgccctggacctccacccggcccgatccggcccgc
tgcttcgtctccctgctgctgcgccccgtcgtcgtccccgaggtccccggcgtcaccggc
gagcgctccatggagatccgcttcatcgcccccggggggctggtgtccaacctggacttc
gttgagggcatcttcggcaacggcggcgacccctacctgccggagaacgacgcctccctg
gcgccggagacctggaccgggcacaccggctgcgtcatcctggccccgcacctgaccgcc
ctgaccaagaaggaactgggactgcccgcgtgggaggaggccgacgagcgccggcgccgc
gacggcatgtgctggcgcgaggaggacgagctctacaacgacggcaagcccttcaagctg
gtggcccgcgacgagcgcggcgtcattgtcaccgtcatcgcggacaactactacggctac
tgcaagaaggaggtcaagacccagatcggctactcggccaacctcttcggctgcgtggag
gaggagcactccggcggggcgatcgccttcccgcgctacgacctgggccgcgagttccgc
gacgtccacacgcccgccgaccgcacgctcgacgacgtcctggccgccaaccccggccgt
ttccgccgcgaggactcgggctgcgccgtcgacctggacgacgagacgatcgtcctggtg
cccggcggggccttctactccatgctcacccagaccatcacctggaccggggcggacggc
gagacggcccgcatcccgctgctggccggcaggacctacgtgacgccgtcgggctaccgc
atccactgcaaggcggccatcggcaaccccaagcagtggcacatgatcggcaccgccccc
tggcacacccagctgcacaagccggccaccgtgtccgggggcggcaagtcggagatctcc
aagtcgatcctcgacgccatcgtcttcggcgaggcctacatcggggacgtggaggccgac
ctggacgccgtccagggcatcctcgacggcgactacgccgaccgcttcgtcgacccggcc
aacaagagcgcccaccaccgctccatcctctccgagcgccgctcgctgggcagtgtcatc
aagctgctcacgccctcggagatgtacacccgggagtacaacgccttcctggagtccatc
ccgccccacatcaaggagctcatcttcacggtcaagcgctactaccgccccgagtggggg
gccgactggcgcagccacttctccgtgggcatgatgaacggccgccagggcaactccctg
cgcctggacggggacaccgtcaagatcaatatgctccgcgtcggcttcgagtccgacggc
gcctggcggctgttctccctgcgccccgacttcgcggcctgcgcgaaggtccagacggag
gacgacatcaccgcctccctggtggcgccggcctccgccgacgacccggccttcgcgcgg
gggctgagccgcaagtacgtcaccaactgcgaggagctgctgttccagcgccccgacgac
gccattgtgcccggctacgacaagcagaccgagtcggacatggccggaacggacctgttc
atctccaactacgcgcccctgacccccgccgacgcacgggccatggtcgacgacgcgccc
gggctgtcgcgcttcaccgagcccatgcagggcctcgtccgccgggcggccgccctgccc
gaggcgccggagccggcccggcggtcctactgggtctgcaccgccaacccgcgcctcgtg
aacggcgcccccacgcggaacccgcgctaccttcaggtgcgcccggacgtcgcccgcccc
gaggaggtgcgcctggccgaggtggccacccacctgtactcccgcgtgcccctgggcgag
ccgatccgccacagcgtcgacgtcgtcgccgccggccggcgcaacaacccgcccgagccg
ggggtgccggccctgtgcgcctacaacccgctgcactacatggagctgcccgagctgttc
atggagttcatctcctccatgaccggcaagtccccctcgaccacgggcgccggcagcgag
ggggcgctgaccaagtcgcccttcaacgcgctgccgcccgtctacgacctcaacgcctcg
ctgctgtcctacgccctgggcggctacgacggctggctgagctcggcgggctacatcggg
cccagggtcagggtcgcccacgacatctcgctgctcgtgccggaggtgttctcgcgcatg
accgaggccgagcgcgacgcccgcgccctcatcgcgggcggctacctggagcgcctggag
gacagggagatcggcgggcgcaccgtccaggcctcgcggctgggctaccgcatgaaccag
gccttcgccaacagcttcttcgggcgcatcttcctgcaccccgacgtcgtgttcaccgag
gagatgctgcgccccgagctgcaggatgaggaggtcttcgccgactccgtcgacgtcatt
gtcaccacccaccgtgtggtcgcccagcactacgtcgacgacggctcgatccggtgggcc
gtgccgccgctgagggcgctgctggagatcatgcactcggggcgctccgagcaggggtgg
acgctggccagcccgcagttccgggccctgttcgagcgggagaacatcctggcctccgac
tggtacgcggcccgcatcgacgccaaggtcgagcgcgaccgcaagcaggccgaggcctcg
atccggtcgctgacccgcttcacgacgacgccgggcaacgagggcgtgaccgagcgcctc
gacgtcggagcgcggctggaggccgcccgggcgcacctggccgaggcggcctcgccggcc
gcccgcgagcgcctggtgggcacgctcggcctccagcccgagctggccgagggcgcgccc
attgacgtggcctga

DBGET integrated database retrieval system