KEGG   Acidiphilium cryptum: Acry_0240Help
Entry
Acry_0240         CDS       T00527                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acr  Acidiphilium cryptum
Pathway
acr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Acry_0240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acr02000]
    Acry_0240
Enzymes [BR:acr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Acry_0240
Transporters [BR:acr02000]
 Other Transporters
  Pores ion channels [TC:1]
   Acry_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: ABQ29468
UniProt: A5FV36
LinkDB All DBs
Position
276467..277087
Genome map
AA seq 206 aa AA seqDB search
MKLFYAPGACSLGIHVLIEELGLPHEGVLVNLRDGQQFSDDYKAINPKAKVPAIVLDDGT
VLTEWIAIANYLAATNPAAQLVPSSPVEAARCNELVAYINGWMHPQGFARIFRPERFAPN
PEDKEAVREQGRKIFAEGFDLIEPVLADGREWLLGAFSIADAALFYVSFWAEGRQTIPLP
PNVSAHYARMKARPAVARAMEQERLS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctatgcgccaggcgcctgctcgctcggcatccatgtcctgatcgaggaa
ctcggcctgccgcatgaaggcgtgctggtgaacctgcgcgacgggcagcagttcagcgac
gactacaaggcgatcaatccgaaggccaaggtgccggcaatcgtgctcgacgacggcacg
gtgctgaccgagtggatcgccatcgcgaactacctggccgcgaccaacccggcggcccag
ctggtgccgtcctccccggtcgaggccgcgcgctgcaacgaactcgtcgcctacatcaac
ggctggatgcatccgcaggggttcgcccgcatcttccgccccgagcgtttcgcgccgaat
cccgaggacaaggaggccgtccgcgagcaggggcggaagatcttcgccgaaggattcgac
ctgatcgagccggtgctggccgatgggcgggagtggctgctcggcgcgttctcgatcgcc
gatgcggcgctgttctacgtctccttctgggcggaaggccggcagacgatcccgctgccg
ccgaatgtctcggcgcattatgcgcggatgaaggcgcgcccggcggtggcgcgggcgatg
gagcaggagcggctgtcctga

DBGET integrated database retrieval system