KEGG   Acidiphilium cryptum: Acry_0825Help
Entry
Acry_0825         CDS       T00527                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acr  Acidiphilium cryptum
Pathway
acr00630  Glyoxylate and dicarboxylate metabolism
acr00710  Carbon fixation in photosynthetic organisms
acr01100  Metabolic pathways
acr01120  Microbial metabolism in diverse environments
acr01200  Carbon metabolism
Module
acr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
acr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acry_0825
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acry_0825
Enzymes [BR:acr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Acry_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABQ30044
UniProt: A5FWR2
LinkDB All DBs
Position
915477..915905
Genome map
AA seq 142 aa AA seqDB search
MRLTQGCFSFLPDLTDEQISRQIQYCLDKGWAVNLEYTDDPHPRNTYWEMWGLPMFDIRD
AKAIMSELADCRRIHDDCYIRLSAFDATNTWESLRISFIVQRPKDEPGFMLTRSEAAGRT
MRYETRAYVVQKPEGARYGNSG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagactgacccagggctgcttttcgtttcttcccgatctgaccgatgaacagatcagc
cgccagatccagtactgcctcgacaagggctgggcggtgaacctcgaatataccgacgac
ccgcacccgcggaatacctactgggaaatgtggggcctgccgatgttcgacatccgcgat
gccaaggcgatcatgtccgaactcgcggactgccggcggattcacgatgattgctatatc
cgcctctcggcgttcgacgccaccaacacatgggagtcgctccgcatttccttcatcgtg
cagcggccgaaggacgaacccggcttcatgctgacgcggagcgaggccgccggccgcacc
atgcgctacgaaacccgcgcctatgtcgtccagaagcccgaaggcgcgcgctatggaaat
tccgggtga

DBGET integrated database retrieval system