KEGG   Acidiphilium cryptum: Acry_1067Help
Entry
Acry_1067         CDS       T00527                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
acr  Acidiphilium cryptum
Pathway
acr00630  Glyoxylate and dicarboxylate metabolism
acr00710  Carbon fixation in photosynthetic organisms
acr01100  Metabolic pathways
acr01120  Microbial metabolism in diverse environments
acr01200  Carbon metabolism
Module
acr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
acr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acry_1067
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acry_1067
Enzymes [BR:acr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Acry_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF2721
Motif
Other DBs
NCBI-ProteinID: ABQ30283
UniProt: A5FXF1
LinkDB All DBs
Position
1190417..1191682
Genome map
AA seq 421 aa AA seqDB search
MSGAERIEADYLIETAFDPGHAAAAMAGEQSSGTFVPVPGETPELKARAAARVERLDVLE
TVGSPSLPGAGTPRGASPPVIRRAAVTLSWPVDNLGPSLPNLVATVAGNLFELRQFSGLR
LLDLRLPASFAAANPGVRFGIPGTRRLAGVEGRPLIGTIVKPSVGFDAGQTAALVATLCE
AGIDFIKDDELQADGPACPFEARARAVMRVVNDHAERTGKKVMFAFNLTGEVDEMRRRHD
LVRELGGTCVMASLNSVGVSGFLALSRHAALPVHAHRNGWGALSRHPLLGWSYVAWQKIW
RLAGADHMHVNGLRNKFSEDDDSVIASARACLTPMSDAAPNVVMPVFSSGQSVRQAGDTY
AALGSADLIYAAGGGIMGHPGGPAEGVAALRAAWDAAMAGIPADEHAKTHPALARALEGA
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcgcggaacgcatcgaagccgattacctgatcgagaccgcgttcgaccccggc
cacgccgccgcggcgatggccggcgagcagtcgagcggcaccttcgtgccggtgcccggc
gaaacccccgaactcaaggcgcgcgccgcggcacgggtcgagcggctcgatgtcctggaa
acggtcggctcgccctccctgcccggcgccggaaccccgcgcggcgcgtcgccgccggtc
atccgccgcgccgccgtcaccctttcctggccggtggacaatctcggcccgtcgctgccc
aatctcgtcgcgaccgtcgccggcaatctcttcgaactgcgccagttctccggcctgcgc
ctgctcgacctgcggctgcccgcgagcttcgccgccgccaatcccggcgtgcgcttcggc
atccccggcacgcggcggcttgccggcgtcgaggggcggccgctgatcggcaccatcgtc
aagcccagcgtcggcttcgatgccgggcagaccgcggcgctggtcgccaccctctgcgag
gccggcatcgacttcatcaaggacgacgagttgcaggccgacggccccgcctgcccgttc
gaggcccgcgcccgcgcggtgatgcgcgtcgtcaacgatcatgccgagcgaaccggaaag
aaggtgatgttcgccttcaacctgaccggcgaggtcgacgagatgcgccgccggcacgac
ctcgtgcgcgagctcggcggcacctgcgtgatggcgagcctcaattccgtgggcgtcagc
ggcttcctcgcgctgtcgcgccacgccgcgctgccggtccacgcgcatcgcaacggctgg
ggcgcgctgtcgcggcacccgctgctgggctggtcctatgtcgcctggcagaagatctgg
cgcctcgccggcgccgaccacatgcatgtgaacggcctgcgcaacaagttctccgaggat
gacgacagcgtcatcgcctccgcgcgcgcctgtctcaccccgatgtccgacgcggcgccg
aacgtcgtcatgccggtcttctcctccggccagtcggtccgccaggcgggcgacacctac
gcggcgctcggctcggccgacctgatctacgccgccggcggcggcatcatgggacatccc
ggcgggccggccgaaggcgtggcggccctgcgcgcggcgtgggacgcggcgatggccggc
attcccgccgacgagcacgcgaagacgcacccggcgctggcccgggcgctggagggcgcg
tcctga

DBGET integrated database retrieval system